LOADING...
   NP_418828.1;C.LS21333A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_418828.1    C.LS21333A            JCSG 430423 Crystal Hit 14-SEP-23

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_418828.1
DESCRIPTIONgi|16124264|ref|NP_418828.1| chromosomal replication initiator protein DnaA [Cau
lobacter crescentus CB15]
ORGANISMCAULOBACTER CRESCENTUS
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00308; Bac_DnaA;
DR Pfam; PF08299; Bac_DnaA_C;
DR PDB; 2Z4R; Highly similar; 19-FEB-08; CHROMOSOMAL REPLICATION INITIATOR PROTEIN DNAA;
DR PDB; 2Z4S; Highly similar; 19-FEB-08; CHROMOSOMAL REPLICATION INITIATOR PROTEIN DNAA;
DR FFAS; 430427; Fold and function assignment.
DR TVPC; NP_418828.1; Homologs in PDB, JCSG and SG center.
DR OVP; C.LS21333A; Ortholog view popup.
DR TPM; NP_418828.1; Target PDB monitor.
DR FSS; NP_418828.1; Target function coverage.
PROPERTY Residues: 490 aa
Molecule Weight: 53880.49 Dalton
Isoelectric Point: 8.94
Extinction Coefficient: 49960
Gravy Index: -.2
Number of Met residues: 11
Percentage of Met residues: 2.24 %
Number of Cys residues: 3
Percentage of Cys residues: 0.61 %
SEQUENCE  amino acids 490 aa
>NP_418828.1  gi|16124264|ref|NP_418828.1| chromosomal replication initiator protein DnaA [Caulobacter crescentus 
MTMKGGVASQDFSAAIATACEPAANVWSKVCVALKRELGDAAFGSWIAPAMLREAATGDV
VLVTSTGIARDWIRRSAWRRIGELWAAHDATGRRIDLKSRLEFEAAAGAYVEATPKAVAA
EPIEIVLPVSTDAPTVVAPSAKSPRTQGLQERFTFETFVPGPANEFAHAVARRIANWADG
HFNPVLFHGPYGFGKTHLLNALAWEAMRNAPEKRVVYLTAERFLSTFVRAVMDRQTAAFK
EELRAADLLIIDDVHFIAGKQSTQEELFHTLTALVGEGGRVVFSADRPPSAMTEMDAHLR
SHLSAGLVCGLEPADRNLRLGILERKIQTLGAAHGFEPSIRPEVMQFLADRFTDSVRELE
GALNTLSARAGEGLSRMTLDEVQAILRPHLRSGEKRITIDDIQKATAEHYGMKQADLLSE
RRNRAVARPRQAAMWLAKQLTTRSLPDIGRRFGGRDHTTVLHAVRRIEALRAEDSALSHD
LETLTRKLRG

CDS  cDNA 1473 bp
   1 atgaccatga agggcggggt tgccagccag gacttctcgg cggcgatcgc gacggcttgt    60
  61 gagccggcgg cgaacgtctg gtcgaaggtt tgcgtggctt tgaagcgtga gctgggtgac   120
 121 gcggccttcg ggtcgtggat cgcgcccgcc atgctgcgcg aagccgccac tggcgatgtc   180
 181 gtcctggtga cgtcgacggg catcgcccgc gactggattc gccgcagcgc ctggcgccgg   240
 241 atcggcgaac tctgggccgc ccatgatgcg acaggtcgtc gcatcgacct gaagtcgcgc   300
 301 ctcgagttcg aagcggcggc cggcgcctat gtagaggcga cccccaaggc tgtcgccgcc   360
 361 gaaccgatcg agattgtcct gcccgtctcc actgacgcgc cgacggtcgt cgcgcccagc   420
 421 gccaagtcgc cccgcaccca aggcttgcag gagcgcttca ccttcgagac cttcgtcccg   480
 481 ggtcccgcca acgagttcgc gcacgctgta gcgcgtcgga tcgccaactg ggcggacggt   540
 541 cacttcaatc ctgtgctgtt ccacggcccg tacggttttg gcaaaacgca cttgctgaac   600
 601 gccctggcct gggaggccat gcgcaacgcc ccggaaaagc gcgtggtcta tctgaccgcc   660
 661 gagcgcttcc tgtcgacctt cgtgcgcgcc gtgatggatc gtcagaccgc ggccttcaag   720
 721 gaagagctgc gcgccgctga tcttctgatc atcgacgacg tgcacttcat cgccggcaag   780
 781 cagtcgaccc aggaagagct gttccacacc ctgaccgcgc tggtcgggga gggcggccgt   840
 841 gtcgtgttct cagccgaccg tccgccgtcg gccatgaccg agatggacgc ccatctgcgc   900
 901 tcgcatctgt cggcgggtct ggtctgcggt ctcgagccgg cggatcgcaa cctccgtctc   960
 961 ggcatcctgg agcgcaagat ccagaccctg ggcgcggccc acggctttga gcccagcata  1020
1021 cgccccgagg tcatgcagtt cctcgccgac cgtttcaccg acagcgtccg cgagctggaa  1080
1081 ggcgcgctga acaccttgtc ggcccgcgcc ggcgaaggcc tctcgcgcat gaccctggat  1140
1141 gaggtgcagg cgatcctgcg tccccacctg cggtcgggcg agaagcgcat caccatcgac  1200
1201 gatattcaga aggccaccgc cgagcattac ggcatgaagc aggccgatct gcttagcgaa  1260
1261 cgccgcaacc gcgccgtggc ccggccgcgt caggccgcca tgtggctggc caagcagctg  1320
1321 accacccgtt cgctgccgga catcggccgt cgcttcggtg gtcgcgatca caccacggtc  1380
1381 ctgcacgccg tccgtcggat cgaggccttg cgcgctgagg acagcgcctt gagccacgat  1440
1441 ctggagaccc tgacgcgcaa gctgcggggc taa  1473
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
5636 7108 2 Glimmer3 score 15.11 good
Genemark probabilities .89   .69 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu