LOADING...
   NP_421019.1;CC20728A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_421019.1    CC20728A            JCSG 423140 Plasmid Purification 11-JUN-10

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_421019.1
DESCRIPTIONgi|16126455|ref|NP_421019.1| cell division ATP-binding protein FtsE [Caulobacter
crescentus CB15]
ORGANISMCAULOBACTER CRESCENTUS
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00005; ABC_tran;
DR PDB; 3DHW; Highly similar; 05-AUG-08; D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN ME CHAIN: A,;
DR PDB; 3TUI; Highly similar; 30-NOV-11; D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN ME CHAIN: A,;
DR PDB; 3TUJ; Highly similar; 30-NOV-11; D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN ME CHAIN: A,;
DR PDB; 3TUZ; Highly similar; 30-NOV-11; D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN ME CHAIN: A,;
DR PDB; 2PCJ; Highly similar; 02-OCT-07; LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN CHAIN: A, B;
DR PDB; 2PCL; Highly similar; 02-OCT-07; LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN CHAIN: A;
DR FFAS; 423140; Fold and function assignment.
DR TVPC; NP_421019.1; Homologs in PDB, JCSG and SG center.
DR OVP; CC20728A; Ortholog view popup.
DR TPM; NP_421019.1; Target PDB monitor.
DR FSS; NP_421019.1; Target function coverage.
PROPERTY Residues: 222 aa
Molecule Weight: 24573.02 Dalton
Isoelectric Point: 9.83
Extinction Coefficient: 9970
Gravy Index: -.03
Number of Met residues: 4
Percentage of Met residues: 1.80 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 222 aa
>NP_421019.1  gi|16126455|ref|NP_421019.1| cell division ATP-binding protein FtsE [Caulobacter crescentus CB15]
MVRFEGVSMRYGRGPETLRDISFSLEPGSFHFLTGASGAGKSSLLKLIYLAHRASRGRVE
LFGRDVSLTHASDLPFLRRRIGVVFQEFRLLEHLSVFDNAALPLRILGRKPATYREDVAE
LLTWVGLGERMHALPATLSGGEKQRLAIARAVVDRPDVLLADEPTGNVDPAMSLRLLRLF
VELNRLGTTVLIATHDEDLVARAARPTLHLEHGRLVDLGGRP

CDS  cDNA 669 bp
   1 gtggtccgct tcgaaggcgt gtcgatgcgc tatgggcggg gtccggaaac cctcagagat    60
  61 ataagctttt ccctggagcc gggatcgttc cacttcctga ccggcgcgtc gggggcgggc   120
 121 aagagctcgc tgcttaagct gatctatctg gcgcaccgtg cgtcacgggg tcgcgtggag   180
 181 ctgttcgggc gtgatgtgag cctgacccac gcctcggacc ttcccttcct gcgccgtcgc   240
 241 atcggggtgg tcttccagga gttccggctg ctggagcacc tgtcggtgtt cgacaacgcc   300
 301 gccctgccct tgcggattct cggtcgcaag ccggccacct atcgcgagga cgtggccgag   360
 361 ctcttgacct gggtgggcct gggcgagcgc atgcacgccc tgcccgccac gctgtcgggc   420
 421 ggcgagaagc aacgcctggc catcgcccgc gccgtcgtcg accgtcccga cgtgctgctg   480
 481 gccgacgagc cgaccggcaa tgtcgatccg gccatgtcgc tgcgcctgct gcgcctgttc   540
 541 gtcgaactga accgcctggg caccacggtg ctgatcgcca cccacgacga ggaccttgta   600
 601 gcgcgcgccg cgcgtccgac cctgcacctg gagcatggac gcctcgtgga tctgggaggc   660
 661 cggccatga   669
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2419880 2420548 2 Glimmer3 score - -
Genemark probabilities .8   .96 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu