LOADING...
   CE21227;CE21227
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
CE21227    CE21227            JCSG 1315 PDB Deposition 04-JUN-11              PDB id: 1vko

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONCE21227
DESCRIPTIONinositol-3-phosphate synthase. VF13D12L.3 protein.
ORGANISMCaenorhabditis elegans
COMMENT 
DR UNIPROT;
DR SPTR; Q9XTB4 (flat text); Q9XTB4 (good view)
DR GenBank; CAA88951
DR Pfam; PF07994; NAD_binding_5;
DR Pfam; PF01658; Inos-1-P_synth;
DR Interpro; IPR003767; ldh_2;
DR PDB; 1VKO; Identical; 17-AUG-04; INOSITOL-3-PHOSPHATE SYNTHASE;
DR PDB; 1JKF; Highly similar; 10-APR-02; MYO-INOSITOL-1-PHOSPHATE SYNTHASE;
DR PDB; 1JKI; Highly similar; 10-APR-02; MYO-INOSITOL-1-PHOSPHATE SYNTHASE;
DR PDB; 1LA2; Highly similar; 10-APR-02; MYO-INOSITOL-1-PHOSPHATE SYNTHASE;
DR PDB; 1P1F; Highly similar; 08-JUL-03; INOSITOL-3-PHOSPHATE SYNTHASE;
DR PDB; 1P1H; Highly similar; 08-JUL-03; INOSITOL-3-PHOSPHATE SYNTHASE;
DR PDB; 1P1I; Highly similar; 08-JUL-03; INOSITOL-3-PHOSPHATE SYNTHASE;
DR PDB; 1P1J; Highly similar; 08-JUL-03; INOSITOL-3-PHOSPHATE SYNTHASE;
DR FFAS; 1315; Fold and function assignment.
DR TVPC; CE21227; Homologs in PDB, JCSG and SG center.
DR OVP; CE21227; Ortholog view popup.
DR TPM; CE21227; Target PDB monitor.
DR FSS; CE21227; Target function coverage.
PROPERTY Residues: 525 aa
Molecule Weight: 58475.28 Dalton
Isoelectric Point: 5.82
Extinction Coefficient: 43320
Gravy Index: -.25
Number of Met residues: 11
Percentage of Met residues: 2.10 %
Number of Cys residues: 4
Percentage of Cys residues: 0.76 %
SEQUENCE  amino acids 525 aa
>CE21227  VF13D12L.1 CE21227 myo-inisitol-1-phosphate synthase (HINXTON) TR:Q18664 protein_id:CAA93771.1
MSSAQVNGISKRLIVESPNVKLEDGVLESRFTYRKNHFEHRADGLHVTPKEHDYSFKTVL
KPRKTGLLLVGLGGNNGSTAVGSIFANQYAMTWRTKEGHSQANYFGSVTQTATVHLGYDS
ATQNQIFVPFKDIVPILSPNDLIISGWDISDSNLYEAMGRAKVFEPELQEKLRPFMEPIV
PLPSIYYPDFIASNQGDRANNVIPGDNKLEHLEHIRADIRKFKQEHELECVIVLWTANTE
RYTDVRQGLNATADEIMESIRVNEDEVSPSNIFAVASILEGAHYINGSPQNTLVPGLIEL
AERHKVFVGGDDFKSGQTKFKSAFVDFLVSSGMKPESIVSYNHLGNNDGKNLSEARQFRS
KEISKSSVVDDMVKSNQILFPDAKNPDYCVVIKYVPYVADSKRAMDEYICSIFMGGKQTF
VVHNTCEDSLLASPLIYDLAILTELASRVSYKVDDEYKPFHSVLSILSLLLKAPVVPPGT
PISNAFMRQFSTLTKLVTALAGFPSDTDMQIEFFTQLPAAKSKSQ

CDS  cDNA 1578 bp
   1 atgagctcgg cccaagttaa tggaatctcg aagagattga tcgtcgaatc gccgaatgtg    60
  61 aagctggagg acggagtgct cgaaagtcgg ttcacctatc gcaagaacca ctttgagcat   120
 121 cgtgccgatg ggctccacgt gacgccgaag gagcacgact actcgttcaa gacggtactc   180
 181 aagccacgca agactgggct cttgttggtg ggactcggcg gcaacaacgg ctcgaccgca   240
 241 gtcggatcca tcttcgccaa ccagtacgcg atgacgtggc ggaccaagga gggacacagt   300
 301 caggcaaatt attttgggtc cgtgacccaa actgcgactg ttcacttggg ctacgactct   360
 361 gccacccaga atcagatctt cgtgccattc aaggacatcg tgccgattct ctcgccgaac   420
 421 gacttgatca tcagcggttg ggacatcagc gactcgaacc tgtacgaggc tatggggcgt   480
 481 gctaaggttt tcgaacctga gcttcaggag aagctccgcc cattcatgga gcccatcgta   540
 541 ccgctgccgt cgatctacta tccggacttt atcgcttcga atcagggaga tcgtgcgaat   600
 601 aatgtgatcc caggagacaa caagttggag catttggagc acattcgagc tgatattcgc   660
 661 aagttcaagc aggagcacga gctggaatgt gtgatcgtgt tgtggacggc caacacggag   720
 721 cgatacacgg atgttcgcca ggggctcaac gccaccgccg acgagattat ggagtcgatt   780
 781 cgtgtgaatg aggacgaggt gtcgccgtcg aacatctttg cggtggcatc gattcttgaa   840
 841 ggtgctcact acatcaatgg atcgccgcag aatacgctcg tgccagggct catcgagctc   900
 901 gccgagcgtc acaaagtctt cgtgggaggt gatgatttca agtcgggaca gacgaagttc   960
 961 aaatcggcgt tcgtggactt cctggtgagc agtggtatga agcccgaatc gatcgtctcg  1020
1021 tacaaccatc tcggaaacaa tgacggaaag aacttgagcg aggcgagaca attccgctcg  1080
1081 aaggagatct cgaaatcatc ggtcgtcgat gatatggtca aatcgaatca gatcctcttc  1140
1141 ccagatgcca agaatccgga ttactgcgtt gtgatcaagt atgtaccata tgttgctgat  1200
1201 tcgaagagag ccatggacga atatatctgc agtatcttca tgggcggaaa gcagactttc  1260
1261 gtggttcaca acacgtgcga ggactctttg ctcgcctcgc ctctcatcta cgacctggcg  1320
1321 attctcacgg agctcgcgag ccgtgtctcc tacaaagtcg acgacgagta caagccattc  1380
1381 cattcggtgc tctcgatcct ttcgctgctc ctgaaggctc cagttgtgcc accgggcacg  1440
1441 ccgatcagca atgccttcat gcgacaattc tcgacgctca cgaagctggt gaccgcgttg  1500
1501 gcaggattcc catcggacac tgatatgcaa atcgaattct tcacccaact tccggcggca  1560
1561 aaatcgaaat ctcagtga  1578
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu