LOADING...
   YP_563020.1;FL10895A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_563020.1    FL10895A            JCSG 376176 Crystal Hit 07-JUN-05

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_563020.1
DESCRIPTIONgi|91793369|ref|YP_563020.1| radical activating enzyme [Shewanella denitrificans
OS217]
ORGANISMSHEWANELLA DENITRIFICANS OS-217
COMMENT 
DR UNIPROT; Q12MM9_SHEDO
DR SPTR; Q12MM9 (flat text); Q12MM9 (good view)
DR GenBank; YP_563020
DR PDB; 4NJG; Highly similar; 25-DEC-13; 7-CARBOXY-7-DEAZAGUANINE SYNTHASE;
DR PDB; 4NJH; Highly similar; 25-DEC-13; 7-CARBOXY-7-DEAZAGUANINE SYNTHASE;
DR PDB; 4NJI; Highly similar; 25-DEC-13; 7-CARBOXY-7-DEAZAGUANINE SYNTHASE;
DR PDB; 4NJJ; Highly similar; 25-DEC-13; 7-CARBOXY-7-DEAZAGUANINE SYNTHASE;
DR PDB; 4NJK; Highly similar; 25-DEC-13; 7-CARBOXY-7-DEAZAGUANINE SYNTHASE;
DR FFAS; 376176; Fold and function assignment.
DR TVPC; YP_563020.1; Homologs in PDB, JCSG and SG center.
DR OVP; FL10895A; Ortholog view popup.
DR TPM; YP_563020.1; Target PDB monitor.
DR FSS; YP_563020.1; Target function coverage.
PROPERTY Residues: 222 aa
Molecule Weight: 24589.9 Dalton
Isoelectric Point: 5.63
Extinction Coefficient: 34950
Gravy Index: -.08
Number of Met residues: 3
Percentage of Met residues: 1.35 %
Number of Cys residues: 8
Percentage of Cys residues: 3.60 %
SEQUENCE  amino acids 222 aa
>YP_563020.1  gi|91793369|ref|YP_563020.1| radical activating enzyme [Shewanella denitrificans OS217]
MNYPVNEVFETIQGEGCFTGVPALFVRLQGCPVGCAWCDTKQTWDVLADNKVTPEQVITV
DGTIGRWANHDGASLITAFKAKGFTAKHIVLTGGEPCLYDLTDITHDFIAAGYSVQIETS
GTFEVKCHQDVWVTVSPKINMKGGYKVLEQALIRANEIKHPIATQNHIDELDELLADIDL
SGKTICLQPISQKVRATELAMKTCIARNWRLSIQTHKYLNID

CDS  cDNA 669 bp
   1 atgaactatc cagtcaacga agtattcgaa accattcaag gcgaaggctg ttttactggc    60
  61 gtgcctgcct tattcgtgcg cctgcaaggc tgccctgtgg gttgtgcttg gtgcgatact   120
 121 aagcagacat gggatgtgct ggccgacaac aaggtgactc ctgagcaggt cattacagta   180
 181 gatggcacca taggccgctg ggccaaccat gatggtgcga gtctcattac cgcgtttaag   240
 241 gctaaaggat tcaccgctaa acatatcgtg ctaacgggtg gtgagccttg tctttatgat   300
 301 ctcaccgaca tcacccatga ctttattgcg gcaggttata gtgttcaaat tgagaccagc   360
 361 ggtacgttcg aggtgaaatg tcatcaagat gtgtgggtga cagtgtcacc taaaatcaat   420
 421 atgaaaggcg gctacaaggt gcttgaacaa gccctgatcc gcgctaatga gattaagcat   480
 481 cccatcgcca cccaaaatca catagacgag ctcgatgagt tgttagcgga tattgacctt   540
 541 agcggtaaaa ccatttgtct gcagccaatc agccagaagg tgagggccac cgagcttgcg   600
 601 atgaaaacct gtatcgctcg caattggcgc ttgtccatcc agactcacaa gtaccttaac   660
 661 atcgattaa   669
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2390787 2391455 -3 Glimmer3 score 9.15 poor
Genemark probabilities .8   .75 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu