LOADING...
   NP_784167.1;GE1527P
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_784167.1    GE1527P            JCSG 396747 PDB Deposition 09-OCT-08              PDB id: 3k69

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_784167.1
DESCRIPTIONPutative transcriptional regulator [DNA/RNA-binding 3-helical bundle]
ORGANISMLactobacillus plantarum
COMMENT 
DR UNIPROT; Q88ZG1_LACPL
DR SPTR; Q88ZG1 (flat text); Q88ZG1 (good view)
DR GenBank; NP_784167
DR Pfam; PF02082; Rrf2;
DR PDB; 3K69; Identical; 03-NOV-09; PUTATIVE TRANSCRIPTION REGULATOR;
DR FFAS; 396747; Fold and function assignment.
DR TVPC; NP_784167.1; Homologs in PDB, JCSG and SG center.
DR OVP; GE1527P; Ortholog view popup.
DR TPM; NP_784167.1; Target PDB monitor.
DR FSS; NP_784167.1; Target function coverage.
PROPERTY Residues: 161 aa
Molecule Weight: 17893.06 Dalton
Isoelectric Point: 5.44
Extinction Coefficient: 11920
Gravy Index: -.3
Number of Met residues: 5
Percentage of Met residues: 3.11 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 161 aa
>NP_784167.1  gi|28377275|ref|NP_784167.1| transcription regulator (putative) [Lactobacillus plantarum WCFS1]
MGGSNMKLDFSVAVHSILYLDAHRDSKVASRELAQSLHLNPVMIRNILSVLHKHGYLTGT
VGKNGGYQLDLALADMNLGDLYDLTIPPTISYARFITGPSKTDEQADQSPIAANISETLT
DLFTVADRQYRAYYHQFTMADLQADLNHHGTFLQHEQDSES

CDS  cDNA 486 bp
   1 gtgggaggaa gtaacatgaa acttgatttt tcggtggcgg tgcatagtat cctgtacctc    60
  61 gatgcacacc gtgatagtaa ggtcgctagt cgggaactcg cgcagtcact gcatcttaac   120
 121 ccggtgatga ttcgcaatat tttatcagtt ctacataagc atgggtattt aacggggacg   180
 181 gttggtaaaa atgggggcta ccaattagac ttggcgttgg ccgatatgaa cctcggcgat   240
 241 ctatatgatt tgaccatccc gccaacaatt agctatgcgc gcttcattac gggaccatcc   300
 301 aaaacggatg aacaggctga tcaatccccg attgcggcca atattagtga aacgttgacg   360
 361 gatttattta cagtagctga ccgtcaatat cgggcttact atcatcagtt tacgatggct   420
 421 gatttacaag ccgacctgaa ccaccacggt acgtttttac aacacgaaca agattcagaa   480
 481 tcttaa   486
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
327579 328064 3 Glimmer3 score - -
Genemark probabilities .8   .04 poor
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu