NP_784167.1;GE1527P |
Protein Sequence Comparative Analysis (PSCA) | |
![]() |
|
NP_784167.1 GE1527P JCSG 396747 PDB Deposition 09-OCT-08 PDB id: 3k69 Protein Sequence Information ![]() ![]()
SEQUENCE amino acids 161 aa >NP_784167.1 gi|28377275|ref|NP_784167.1| transcription regulator (putative) [Lactobacillus plantarum WCFS1] MGGSNMKLDFSVAVHSILYLDAHRDSKVASRELAQSLHLNPVMIRNILSVLHKHGYLTGT VGKNGGYQLDLALADMNLGDLYDLTIPPTISYARFITGPSKTDEQADQSPIAANISETLT DLFTVADRQYRAYYHQFTMADLQADLNHHGTFLQHEQDSES CDS cDNA 486 bp 1 gtgggaggaa gtaacatgaa acttgatttt tcggtggcgg tgcatagtat cctgtacctc 60 61 gatgcacacc gtgatagtaa ggtcgctagt cgggaactcg cgcagtcact gcatcttaac 120 121 ccggtgatga ttcgcaatat tttatcagtt ctacataagc atgggtattt aacggggacg 180 181 gttggtaaaa atgggggcta ccaattagac ttggcgttgg ccgatatgaa cctcggcgat 240 241 ctatatgatt tgaccatccc gccaacaatt agctatgcgc gcttcattac gggaccatcc 300 301 aaaacggatg aacaggctga tcaatccccg attgcggcca atattagtga aacgttgacg 360 361 gatttattta cagtagctga ccgtcaatat cgggcttact atcatcagtt tacgatggct 420 421 gatttacaag ccgacctgaa ccaccacggt acgtttttac aacacgaaca agattcagaa 480 481 tcttaa 486Warning: the change of start codon from ATG/M to GTG/V; Target constructs Download sequence in PIR or FASTA format Chemical properties of sequence with tag
Notes The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951). Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function. |