LOADING...
   YP_001336233.1;GS13662A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001336233.1    GS13662A            JCSG 390295 Protein Purification 10-SEP-29

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001336233.1
DESCRIPTIONgi|152971124|ref|YP_001336233.1| vancomycin sensitivity [Klebsiella pneumoniae s
ubsp. pneumoniae MGH 78578]
ORGANISMKlebsiella pneumoniae subsp. pneumoniae MGH 78578
COMMENT 
DR UNIPROT; A6TBN2_KLEPN
DR SPTR;
DR GenBank;
DR Pfam; PF02698; DUF218;
DR FFAS; 384095; Fold and function assignment.
DR TVPC; YP_001336233.1; Homologs in PDB, JCSG and SG center.
DR OVP; GS13662A; Ortholog view popup.
DR TPM; YP_001336233.1; Target PDB monitor.
DR FSS; YP_001336233.1; Target function coverage.
PROPERTY Residues: 238 aa
Molecule Weight: 27379.3 Dalton
Isoelectric Point: 8.94
Extinction Coefficient: 40340
Gravy Index: -.1
Number of Met residues: 6
Percentage of Met residues: 2.52 %
Number of Cys residues: 2
Percentage of Cys residues: 0.84 %
SEQUENCE  amino acids 238 aa
>YP_001336233.1  gi|152971124|ref|YP_001336233.1| vancomycin sensitivity [Klebsiella pneumoniae subsp. pneumoniae MGH
MLKRAFYSLLVLLGLLLLTVLGLDRWMSWKTAPYIYDELQDLPYRQVGVVLGTAKYYRTG
VINQYYRYRIQGALNAYNSGKVNYLLLSGDNALQSYNEPMTMRRDLIKGGVDPADIVLDY
AGFRTLDSIVRTRKVFDTNDFIIITQRFHCERALFIALHMGIQAQCYAVPSPKDMWSVRL
REFGARFGALADLYIFKREPRFLGPLIPIPAQQHDVPDDAQSYPAVTPEQLLELQKEK

CDS  cDNA 717 bp
   1 atgttaaagc gtgcgttcta cagcctgtta gtcctgctcg gcctgctgct gttgaccgtg    60
  61 ctgggccttg accgctggat gagctggaaa accgcgccct atatctatga tgaactgcag   120
 121 gacctgccct accgtcaggt cggtgtggtg ctgggcaccg ccaaatatta ccgcaccggc   180
 181 gtcatcaatc agtattaccg ttaccgcatc cagggtgcgc tgaacgccta caacagcggc   240
 241 aaggtcaact atctcctgct gagcggcgat aatgctctgc aaagctacaa tgaaccgatg   300
 301 accatgcgtc gggacctgat taaaggcggc gtcgatcccg cggatatcgt actggactat   360
 361 gccggtttcc gtaccctcga ctcgatcgtc cgtacccgga aagtgttcga caccaacgac   420
 421 ttcattatca tcacccagcg cttccactgc gaacgggcgc tgtttatcgc cctgcatatg   480
 481 gggatccagg cccagtgcta cgcggtgccg tcgccgaagg atatgtggag cgtgcggctg   540
 541 cgcgagttcg gcgcccgctt tggcgcgctg gcggacctct atatcttcaa acgggaaccg   600
 601 cgctttctcg gccctctcat cccgattccg gcgcagcagc atgacgtgcc ggatgacgcc   660
 661 cagtcctacc cggccgtcac cccggagcag ctgctggagc tgcagaaaga aaagtag   717
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu