LOADING...
   YP_001304333.1;GS13854A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001304333.1    GS13854A            JCSG 394795 Protein Purification 11-MAY-26

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001304333.1
DESCRIPTIONgi|150009590|ref|YP_001304333.1| hypothetical protein BDI_3003 [Parabacteroides
distasonis ATCC 8503]
ORGANISMParabacteroides distasonis ATCC 8503
COMMENT 
DR UNIPROT; A6LG97_PARD8
DR SPTR; A6LG97 (flat text); A6LG97 (good view)
DR GenBank; YP_001304333
DR FFAS; 384463; Fold and function assignment.
DR TVPC; YP_001304333.1; Homologs in PDB, JCSG and SG center.
DR OVP; GS13854A; Ortholog view popup.
DR TPM; YP_001304333.1; Target PDB monitor.
DR FSS; YP_001304333.1; Target function coverage.
PROPERTY Residues: 357 aa
Molecule Weight: 40566.77 Dalton
Isoelectric Point: 5.18
Extinction Coefficient: 56840
Gravy Index: -.43
Number of Met residues: 11
Percentage of Met residues: 3.08 %
Number of Cys residues: 3
Percentage of Cys residues: 0.84 %
SEQUENCE  amino acids 357 aa
>YP_001304333.1  gi|150009590|ref|YP_001304333.1| hypothetical protein BDI_3003 [Parabacteroides distasonis ATCC 8503
MDKKTVLLASACTLLMISCSNDAELINVAETTGLQTKAFVGEADFQIVDYAGDKCIQFKN
DSVFNAMLWEMNDMSEEERNNIFSGAGFVSQWQLMQEADQEQELIVDNYEKDLSQPWPAH
QIKEFKQKYDDVFMFEPYDSTDFIAHYKLKGSTYSSFVNRRGVFLIGDSVAHAPVYKALE
EYFGSGISLYGNNEATNEKNDINLAESKYQIPGGDYVKVRAIPRFIELQTIENKNYLSLG
FDYLSQKKKVLWKKHRTMIILRLTASGSGSGFEVYNVSIKNYQNKNGVTILLHTDVYNKL
LAKDQGGMLGHVGENPRNSVTIVTPPRFEFSGRMEIWSDEMPESNKGTAKISLKEDW

CDS  cDNA 1074 bp
   1 atggacaaaa agacagtgct tttagcatct gcatgtactt tattgatgat atcatgtagt    60
  61 aatgatgcgg aattgattaa tgttgctgaa acgacaggat tacaaacaaa ggcttttgtt   120
 121 ggtgaagcag atttccaaat tgtagattat gcgggagata aatgtattca gttcaagaat   180
 181 gattccgtct ttaatgcgat gctttgggag atgaatgata tgtcagaaga agagagaaat   240
 241 aatattttct cgggggcagg tttcgtaagt caatggcaac ttatgcaaga agcagatcaa   300
 301 gaacaggagc ttattgtaga caattatgag aaagatctta gccaaccttg gcctgctcat   360
 361 caaatcaaag aattcaaaca aaaatatgat gatgttttca tgtttgaacc ttatgattct   420
 421 acagatttta ttgcgcatta taaattaaaa ggttctacat atagttcttt tgtgaataga   480
 481 aggggggtgt ttttgatagg agatagtgta gcacatgctc ctgtatataa ggctttagag   540
 541 gaatatttcg gatcagggat atcattgtat ggtaataatg aagctacaaa tgaaaagaat   600
 601 gatataaacc tagctgaaag taaatatcaa ataccaggtg gtgattatgt aaaggttcga   660
 661 gctattccaa gatttataga gttacaaact attgaaaata aaaattattt gtcattgggc   720
 721 tttgattatc ttagtcaaaa aaagaaagtt ttatggaaaa aacaccgtac aatgattata   780
 781 ctacgtctta cagcttcagg gtcaggaagt ggttttgaag tatataatgt ttcaattaaa   840
 841 aattatcaga ataaaaatgg ggtaacaatt cttttacata cagatgtata taataaactt   900
 901 ttagctaagg atcaaggagg tatgttaggg catgttggtg aaaatccaag aaactcagtt   960
 961 acaatcgtaa ctcctcctcg atttgagttt tctggacgaa tggaaatttg gtcagatgaa  1020
1021 atgcctgaaa gtaataaagg gactgcaaaa ataagtttaa aagaagactg gtga  1074
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu