LOADING...
   NP_036323.2;MA16098A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_036323.2    MA16098A            JCSG 400355 Plasmid Purification 09-FEB-27

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_036323.2
DESCRIPTIONNP_036323.2 N-acetyltransferase 6 [Homo sapiens]
ORGANISMHOMO SAPIENS
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00583; Acetyltransf_1;
DR FFAS; 400355; Fold and function assignment.
DR TVPC; NP_036323.2; Homologs in PDB, JCSG and SG center.
DR OVP; MA16098A; Ortholog view popup.
DR TPM; NP_036323.2; Target PDB monitor.
DR FSS; NP_036323.2; Target function coverage.
PROPERTY Residues: 308 aa
Molecule Weight: 33829.15 Dalton
Isoelectric Point: 7.75
Extinction Coefficient: 15470
Gravy Index: -.34
Number of Met residues: 6
Percentage of Met residues: 1.95 %
Number of Cys residues: 5
Percentage of Cys residues: 1.62 %
SEQUENCE  amino acids 308 aa
>NP_036323.2  NP_036323.2 N-acetyltransferase 6 [Homo sapiens]
MQELTLSPGPAKLTPTLDPTHRMELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGP
TELTLDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSS
DAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLME
GLEVFARARGFRKLHLTTHDQVHFYTHLGYQLGEPVQGLVFTSRRLPATLLNAFPTAPSP
RPPRKAPNLTAQAAPRGPKGPPLPPPPPLPECLTISPPVPSGPPSKSLLETQYQNVRGRP
IFWMEKDI

CDS  cDNA 924 bp
   1 atgcaagagc tgactctgag ccctggccca gccaagctga cccctacact agaccctaca    60
  61 caccggatgg agctgatcct gagtaccagc ccagctgagc tgactctgga tcctgcgtgc   120
 121 cagccaaagc tgcccctgga ttccacatgc caaccagaga tgaccttcaa tcctggtcca   180
 181 actgagctta ccctggatcc tgaacaccag ccagaggaga ccccagctcc tagcctggct   240
 241 gagttgaccc tggagcctgt gcaccgccga cccgagctcc tggatgcttg tgctgacctc   300
 301 atcaatgatc agtggccccg cagccgcacc tcccgcctgc actccctggg ccagtcctca   360
 361 gatgccttcc ccctctgcct gatgctgcta agcccccacc ccacacttga agcagcaccc   420
 421 gttgtggtgg gccatgcccg cctgtcacgg gtgctgaacc agccccagag cctcttagtg   480
 481 gagacagtgg tggtggcccg ggccctgagg ggccgtggct ttggccgccg cctcatggag   540
 541 ggcctggagg tctttgctcg ggcccggggc ttccgcaagc tgcatctcac cacccatgac   600
 601 caggtgcact tctataccca cctgggctac cagctgggtg agcctgtgca gggcctggtc   660
 661 ttcaccagca gacggctgcc tgccaccctg cttaatgcct tccccacagc cccctctccc   720
 721 cggccaccca ggaaggcccc aaacctgact gcccaagctg ccccaagggg tcccaaggga   780
 781 cctccattgc caccaccccc tcccctacct gagtgcctga ccatctcacc cccagttcca   840
 841 tcagggcccc cttcaaaaag cctgctggag acacaatatc aaaatgtgag ggggcgcccc   900
 901 atattctgga tggaaaaaga catc   924
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu