LOADING...
   YP_165505.1;MH7542A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_165505.1    MH7542A            JCSG 394627 PDB Deposition 09-DEC-10              PDB id: 3l12

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_165505.1
DESCRIPTIONPutative glycerophosphoryl diester phosphodiesterase
ORGANISMSilicibacter pomeroyi dss-3
COMMENT 
DR UNIPROT; Q5LX22_SILPO
DR SPTR; Q5LX22 (flat text); Q5LX22 (good view)
DR GenBank; YP_165505
DR Pfam; PF03009; GDPD;
DR PDB; 3L12; Identical; 29-DEC-09; PUTATIVE GLYCEROPHOSPHORYL DIESTER PHOSPHODIESTER CHAIN: A,;
DR KEGG; 3.1.4.46; Enzyme page
DR FFAS; 394627; Fold and function assignment.
DR TVPC; YP_165505.1; Homologs in PDB, JCSG and SG center.
DR OVP; MH7542A; Ortholog view popup.
DR TPM; YP_165505.1; Target PDB monitor.
DR FSS; YP_165505.1; Target function coverage.
PROPERTY Residues: 312 aa
Molecule Weight: 34225.95 Dalton
Isoelectric Point: 4.97
Extinction Coefficient: 40910
Gravy Index: -.17
Number of Met residues: 12
Percentage of Met residues: 3.85 %
Number of Cys residues: 3
Percentage of Cys residues: 0.96 %
SEQUENCE  amino acids 312 aa
>YP_165505.1  gi|56695158|ref|YP_165505.1| glycerophosphoryl diester phosphodiesterase, putative [Silicibacter pom
MNGFSQLEGLRGHPSVVRVIGHRGARGVMPENTLEGFAFTLAAGVRALEFDVVMTADGVP
VVTHNHHLANAMTRDGQGHWLTGAERQVAEMTYAEIRALDVGGLDGRTVYGRRFPDQAFL
TGIHVPRLGELLDLCAGYGDQAPYLLLELKSDPALMHDHAARAEMVAAVLADVRRYRMEP
RTVMHSFDWALLGECRRQAPDLPTSYLSQLPENADDPGEDSAKPVGPDYDRMTESLPQAV
ASAGGQLWCPYFLDVTPELVAEAHDLGLIVLTWTVNEPEDIRRMATTGVDGIVTDYPGRT
QRILIDMGLSWT

CDS  cDNA 939 bp
   1 atgaacgggt tttcccaact tgaggggctg cgcggccatc cgagcgtcgt gcgcgtcatc    60
  61 ggccatcgcg gcgcgcgtgg ggtgatgccg gaaaacacac tcgaaggctt tgcctttacg   120
 121 ctcgccgccg gggtgcgggc actggaattc gacgtggtga tgacagccga cggcgtgccg   180
 181 gtggtgaccc ataatcacca tcttgcaaat gcgatgaccc gggatggtca gggccactgg   240
 241 ctgaccggcg cggaacgcca ggtcgccgag atgacctacg ccgagatcag ggcactggat   300
 301 gtcggcgggc tcgacgggcg aaccgtctat ggccggcgct ttccggatca ggcctttctg   360
 361 accggcattc atgtaccccg gttgggcgaa ctgctcgacc tttgcgcagg ctatggtgac   420
 421 caggcaccct acctgctgct ggagctgaag tcggatcccg ccctgatgca tgaccacgcg   480
 481 gcgcgcgccg agatggtggc ggcggttctg gccgatgtcc gacgttaccg catggaacca   540
 541 cgcaccgtga tgcacagctt cgactgggcg ctgctgggcg agtgccgtcg gcaggcgccg   600
 601 gatctgccaa cctcatacct gtcgcaattg cccgaaaacg cggacgatcc cggcgaggat   660
 661 tcggccaagc cggtgggacc ggattatgac cggatgaccg aaagcctgcc gcaagcggtc   720
 721 gcgtcggctg gcggacagct gtggtgcccc tattttctgg atgtgacacc cgagcttgtg   780
 781 gccgaggcac atgacctggg cctgatcgtg ctgacctgga cggtcaatga acccgaagat   840
 841 atcaggcgaa tggccacaac cggtgtcgat gggatcgtga ccgattaccc gggacgaacc   900
 901 caacggattc tgatcgacat gggcctgtcc tggacctga   939
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
255034 255972 -1 Glimmer3 score 11.48 poor
Genemark probabilities .89   .41 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu