LOADING...
   YP_755104.1;MI10449AE
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_755104.1    MI10449AE            JCSG 397713 Crystallization 09-SEP-08

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_755104.1
DESCRIPTIONgi|114567950|ref|YP_755104.1| glycosyl transferase, group 1 [Syntrophomonas wolf
ei subsp. wolfei str. Goettingen]
ORGANISMSyntrophomonas wolfei str. Goettingen
COMMENT 
DR UNIPROT; Q0AU71_SYNWW
DR SPTR; Q0AU71 (flat text); Q0AU71 (good view)
DR GenBank; YP_755104
DR Pfam; PF00534; Glycos_transf_1;
DR FFAS; 397713; Fold and function assignment.
DR TVPC; YP_755104.1; Homologs in PDB, JCSG and SG center.
DR OVP; MI10449AE; Ortholog view popup.
DR TPM; YP_755104.1; Target PDB monitor.
DR FSS; YP_755104.1; Target function coverage.
PROPERTY Residues: 345 aa
Molecule Weight: 39053.78 Dalton
Isoelectric Point: 5.86
Extinction Coefficient: 49850
Gravy Index: -.2
Number of Met residues: 8
Percentage of Met residues: 2.32 %
Number of Cys residues: 1
Percentage of Cys residues: 0.29 %
SEQUENCE  amino acids 345 aa
>YP_755104.1  gi|114567950|ref|YP_755104.1| glycosyl transferase, group 1 [Syntrophomonas wolfei subsp. wolfei str
MNWESTPVLMLTPFHHMQRGNTLTTLRLQTALRQRGFTVDLLSLEEKGWRDSLREYLING
KYSLVHGFNARYFGGVLTEFPELRNLPLILTTTGSDLNYDLKNSGRDLVLAAFAAAEKII
VFHDYFQKLIGDAYPEYCSKLSTIPQGVWLEESPPIKREMIGLAADNIVFALPSGLRPVK
DIELAIDGLQRVYKDFPELRLLIIGPVIDRDYGQKIKQRVSELNWVFYLGEVLHSDMGNY
LSLADVILNTSQAEGQPQGLLEGMSQNKPAILTAVPGNLDIIEEGRQGYYVRNQEELAVA
ARKMLSSAESRQRMGWEAGKLVKEKFSLAREIQSYAELYRQVLSP

CDS  cDNA 1038 bp
   1 atgaactggg aatctacgcc agttctgatg ctaacacctt tccaccatat gcagcggggg    60
  61 aataccttga ccacgctgcg cctgcaaacg gccttaagac agcgaggttt caccgtggat   120
 121 cttttgtctt tggaggaaaa gggatggcgg gatagcctgc gcgagtatct aattaacggc   180
 181 aagtattcgc tggtgcacgg ttttaatgcc cgctattttg gcggggtgct gacggagttt   240
 241 cctgagctcc gaaatttgcc gcttattcta accacaaccg gcagcgattt aaattatgat   300
 301 ctcaagaact cggggagaga cctggttctg gctgcttttg ccgcagcaga gaaaatcata   360
 361 gtcttccatg attatttcca aaaattaatt ggggatgctt atccggagta ttgttctaag   420
 421 ctttcaacca taccccaggg agtatggctg gaagaaagtc ctcccataaa acgagaaatg   480
 481 atagggctgg cagcagataa tatcgtattt gctctgccca gcggcctccg tccagtaaaa   540
 541 gatatcgaac tggctattga tgggctgcaa agggtgtata aggattttcc tgagcttcgt   600
 601 ctgctgatta ttggcccagt gattgatcgg gactatggcc aaaagatcaa gcagcgggta   660
 661 agtgagctga attgggtatt ttatctggga gaagttttac atagtgatat gggaaactat   720
 721 ttgtcgctgg ctgatgtaat actcaacacc tcccaggcgg aaggacaacc ccagggattg   780
 781 ctggagggta tgagccagaa caaaccggct atattgactg ctgtaccggg aaatctggac   840
 841 attattgagg aaggacggca aggatactat gtaaggaacc aggaggaatt ggctgtggca   900
 901 gcccggaaga tgctgtcctc ggcggaaagc cgtcaaagaa tgggctggga ggccgggaaa   960
 961 ctggtaaaag aaaaattctc gctggccagg gaaatacaga gctatgcaga attatatcgt  1020
1021 caagtcctta gtccttaa  1038
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu