LOADING...
   YP_137184.1;MJ12771A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_137184.1    MJ12771A            JCSG 403034 Protein Purification 09-OCT-17

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_137184.1
DESCRIPTIONgi|55379334|ref|YP_137184.1| GTP-binding proteinlike [Haloarcula marismortui ATC
C 43049]
ORGANISMHALOARCULA MARISMORTUI ATCC 43049
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF01926; MMR_HSR1;
DR FFAS; 403034; Fold and function assignment.
DR TVPC; YP_137184.1; Homologs in PDB, JCSG and SG center.
DR OVP; MJ12771A; Ortholog view popup.
DR TPM; YP_137184.1; Target PDB monitor.
DR FSS; YP_137184.1; Target function coverage.
PROPERTY Residues: 213 aa
Molecule Weight: 23881.39 Dalton
Isoelectric Point: 4.7
Extinction Coefficient: 19940
Gravy Index: -.53
Number of Met residues: 5
Percentage of Met residues: 2.35 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 213 aa
>YP_137184.1  gi|55379334|ref|YP_137184.1| GTP-binding proteinlike [Haloarcula marismortui ATCC 43049]
MGLLTNLKDSISRAASTLFSEEDPKRIGIYGPPNAGKTTLANRIARDWTGDAVGPESHVP
HETRRARRKENVEIERDGKKVTIDIVDTPGVTTKVDYTEFLEHDMEKDDAVRRSREATEG
VAEAMHWLREDVDGVIYVLDSATDPFTQVNTMLIGIIESQDLPVLILANKIDLEESSVQR
IRNAYPQHETIPLSALEGDNMDEVYDKIAEYFG

CDS  cDNA 642 bp
   1 atgggattgt taacaaacct caaagatagc atttcacgtg cggcatcgac actgttctcc    60
  61 gaagaggatc cgaagcgtat cggaatctac ggcccgccga acgccggcaa gacgacgttg   120
 121 gcgaaccgca ttgcacgaga ctggaccggc gacgccgtcg gcccggagag tcacgttccc   180
 181 cacgagactc gtcgtgcgcg ccgaaaggag aacgttgaaa tcgaacgcga cgggaagaaa   240
 241 gtgacaatcg atatcgtcga cacgccgggc gtgacgacga aagtcgatta caccgagttc   300
 301 ctcgaacacg acatggagaa agacgacgcc gtccgtcgct cccgcgaagc gactgagggt   360
 361 gtcgccgaag cgatgcactg gctccgcgag gatgtcgacg gcgtcattta cgtgcttgac   420
 421 tccgcgaccg atccgttcac gcaggtcaac accatgctca tcgggatcat cgagagtcag   480
 481 gaccttccgg tgttgatcct cgcaaacaag atcgacctgg aggagtcttc ggttcagcgc   540
 541 atccgaaacg cctaccccca gcacgagacg attccgctgt cagcgcttga gggcgacaac   600
 601 atggacgaag tctacgacaa aatcgcggag tacttcgggt ga   642
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu