LOADING...
   ZP_02421340.1;PI20585C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02421340.1    PI20585C            JCSG 420871 Crystallization 10-NOV-17

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02421340.1
DESCRIPTIONgi|167749213|ref|ZP_02421340.1| hypothetical protein EUBSIR_00164 [Eubacterium s
iraeum DSM 15702]
ORGANISMEubacterium siraeum DSM 15702
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF07963; N_methyl;
DR FFAS; 420821; Fold and function assignment.
DR TVPC; ZP_02421340.1; Homologs in PDB, JCSG and SG center.
DR OVP; PI20585C; Ortholog view popup.
DR TPM; ZP_02421340.1; Target PDB monitor.
DR FSS; ZP_02421340.1; Target function coverage.
PROPERTY Residues: 224 aa
Molecule Weight: 24232.1 Dalton
Isoelectric Point: 4.83
Extinction Coefficient: 37930
Gravy Index: .11
Number of Met residues: 4
Percentage of Met residues: 1.79 %
Number of Cys residues: 2
Percentage of Cys residues: 0.89 %
SEQUENCE  amino acids 224 aa
>ZP_02421340.1  gi|167749213|ref|ZP_02421340.1| hypothetical protein EUBSIR_00164 [Eubacterium siraeum DSM 15702]
MQKNGNILKKRGFTLVELIVTIAIFAVIAAILVPTLLGFTQSARITSANRTASELKKSIA
YFLTKADAYSKNYMRISEGSREVFTVTVTGGVWTVNAVEHPDAFSPDTVSWGSTAIIRPE
TTVSSSSYGEELLGIHLRDTFPELKNGVFRANCIQGMCLSVWFSPDMNDISALVNLPEFG
ETNAWVDENGAYTDAYVWDGSTAGVTADGYILGTAPVLDLATQS

CDS  cDNA 675 bp
   1 atgcaaaaaa acggaaatat tcttaaaaaa cgtggtttta ccttagtgga actgatagtc    60
  61 acaattgcaa tttttgctgt tatagcggcg atacttgttc ctacattatt agggtttaca   120
 121 cagtcggcac ggataacatc ggcaaaccgc actgcatcgg agctgaaaaa atccattgca   180
 181 tatttcctta caaaagccga cgcttacagt aaaaactata tgcgtatatc ggaagggagc   240
 241 cgtgaggtat ttaccgttac ggttacgggc ggagtgtgga cagtgaacgc agtagaacat   300
 301 cccgatgcgt tttctcccga tacggtttcg tggggaagca ctgcgattat aagacccgaa   360
 361 actactgtat cctcgtcaag ctacggcgaa gaactgctcg gcattcatct gcgtgacacg   420
 421 tttcctgaac ttaaaaacgg agtgttccgt gcaaactgca ttcagggtat gtgtctttcg   480
 481 gtatggtttt cacccgatat gaatgatata agtgccttgg tgaatctgcc ggagttcgga   540
 541 gaaacaaatg cgtgggtaga tgaaaacggt gcgtacacag atgcgtatgt gtgggatggc   600
 601 agtacagccg gagtgaccgc tgacggttac atactcggaa ctgcacctgt gcttgatttg   660
 661 gcgacacaga gttaa   675
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu