LOADING...
   NP_873685.1;PU9803C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_873685.1    PU9803C            JCSG 381379 Crystal Hit 07-OCT-11

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_873685.1
DESCRIPTIONgi|33152332|ref|NP_873685.1| ribosomal protein S6 modification protein [Haemophi
lus ducreyi 35000HP]
ORGANISMHaemophilus ducreyi 35000HP
COMMENT 
DR UNIPROT; RIMK_HAEDU
DR SPTR; Q7VLZ5 (flat text); Q7VLZ5 (good view)
DR GenBank; NP_873685
DR Pfam; PF08443; RimK;
DR PDB; 4IWX; Highly similar; 08-MAY-13; RIBOSOMAL PROTEIN S6 MODIFICATION PROTEIN;
DR PDB; 4IWY; Highly similar; 08-MAY-13; RIBOSOMAL PROTEIN S6 MODIFICATION PROTEIN;
DR FFAS; 381379; Fold and function assignment.
DR TVPC; NP_873685.1; Homologs in PDB, JCSG and SG center.
DR OVP; PU9803C; Ortholog view popup.
DR TPM; NP_873685.1; Target PDB monitor.
DR FSS; NP_873685.1; Target function coverage.
PROPERTY Residues: 305 aa
Molecule Weight: 33376.02 Dalton
Isoelectric Point: 8.63
Extinction Coefficient: 15930
Gravy Index: .16
Number of Met residues: 8
Percentage of Met residues: 2.62 %
Number of Cys residues: 7
Percentage of Cys residues: 2.30 %
SEQUENCE  amino acids 305 aa
>NP_873685.1  gi|33152332|ref|NP_873685.1| ribosomal protein S6 modification protein [Haemophilus ducreyi 35000HP]
MKILMLCREPRLYSCQRLKQACQDRNIQLDILDPNRMLIKLAVIDAQMQAQLYYQAGEIY
DKCRAEPSLLAEYDAVLPRFGVSSTMMGCRVLDYFAAKKVVILNNSTAFRLARDKWSSLQ
VLAAQHIPIPTSSFAGALFSTAAHISQHRIPLVIKTCSGSQGVGVMLSESKVHSVSLLQT
LQQAKVDNLLQDFVVEARGQDIRAFVIGDRVVAAIERNGLENDFRANIHQGGSASVIQLN
TAEQQLAVLAAKTIGLDVAGVDLIRSNKGLLVLEVNACPGLDGIEKASKLDIAGLIIDYL
LAMKK

CDS  cDNA 918 bp
   1 atgaagatac ttatgctatg ccgtgaaccg cggctatata gttgccaacg tctaaaacag    60
  61 gcttgtcaag atcgtaatat tcagttagat attcttgatc caaatagaat gctgattaaa   120
 121 ttagcggtaa ttgatgctca aatgcaagca caactttatt atcaagcggg tgaaatttat   180
 181 gataaatgcc gtgcagagcc tagcttgtta gcagaatatg atgcagtatt acctcgtttt   240
 241 ggtgtttcta gtacaatgat ggggtgccgc gtgttagatt attttgcggc taaaaaggtt   300
 301 gttattttaa ataattcaac cgcttttcgt ttagcgcgtg ataaatggtc tagtttgcaa   360
 361 gttctagccg cacaacacat tcccattccc accagttcat ttgccggtgc gctatttagt   420
 421 actgcggcgc atatatctca acatagaatc ccattagtga ttaaaacttg tagtggatca   480
 481 caaggtgtcg gggtgatgtt gagtgagagt aaagtacatt ctgtcagctt attgcaaacg   540
 541 ctacagcaag cgaaagtaga taatttatta caggattttg ttgttgaagc acgcgggcag   600
 601 gatattcggg cttttgtgat tggtgatcgc gttgtggcag cgatcgagcg taatgggcta   660
 661 gaaaatgatt ttagagcaaa tattcatcaa ggtggatccg caagcgttat tcaattaaat   720
 721 accgctgaac aacaattagc ggtgcttgcg gcaaaaacaa tagggcttga tgtagctggt   780
 781 gttgatttaa ttcgctcaaa taaaggctta ttagtgctag aagtgaatgc ttgtccggga   840
 841 ttagatggga tagaaaaagc cagtaaacta gacattgccg gcttaatcat tgattatctg   900
 901 ttagcgatga aaaaatag   918
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1005195 1006112 3 Glimmer3 score - -
Genemark probabilities .89   .04 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu