LOADING...
   YP_001095162.1;PU9803J
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001095162.1    PU9803J            JCSG 381332 Screening 07-DEC-14

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001095162.1
DESCRIPTIONgi|127513965|ref|YP_001095162.1| alpha-L-glutamate ligases, RimK family [Shewane
lla loihica PV-4]
ORGANISMSHEWANELLA SP. PV-4
COMMENT 
DR UNIPROT; A3QHF5_SHELP
DR SPTR; A3QHF5 (flat text); A3QHF5 (good view)
DR GenBank; YP_001095162
DR Pfam; PF08443; RimK;
DR PDB; 4IWX; Highly similar; 08-MAY-13; RIBOSOMAL PROTEIN S6 MODIFICATION PROTEIN;
DR PDB; 4IWY; Highly similar; 08-MAY-13; RIBOSOMAL PROTEIN S6 MODIFICATION PROTEIN;
DR FFAS; 381332; Fold and function assignment.
DR TVPC; YP_001095162.1; Homologs in PDB, JCSG and SG center.
DR OVP; PU9803J; Ortholog view popup.
DR TPM; YP_001095162.1; Target PDB monitor.
DR FSS; YP_001095162.1; Target function coverage.
PROPERTY Residues: 317 aa
Molecule Weight: 35112.15 Dalton
Isoelectric Point: 4.96
Extinction Coefficient: 14900
Gravy Index: -.01
Number of Met residues: 3
Percentage of Met residues: 0.95 %
Number of Cys residues: 5
Percentage of Cys residues: 1.58 %
SEQUENCE  amino acids 317 aa
>YP_001095162.1  gi|127513965|ref|YP_001095162.1| alpha-L-glutamate ligases, RimK family [Shewanella loihica PV-4]
MKIAILTTNQVDDDNRLVEVARAKGHDAFLLDLRQISIELLPSNPEIYYQNEVITNQFDI
VIPRLNVSYTDFGINILQQFICAGIYVSESPEALRLGRDKLKCLQYLLSKDLPFPATAIA
YTPEYLETLVGHLKLPLVVKLIESTEGTGVFLAKTKKEVDNLCKTFSLAGVSYQIQEFIA
EAAGQDIRAFVVGDRVVSAMQRESQDDDFRANVSLGAHSAAVQLTPEEEQVVLRATQSIG
VNIAGVDFVRSSRGPLLLEINVSPDFTGKQGLETVTNCNIAAAIIDYTLSEAKGFYRHQR
LMASRVRREEDLLCADG

CDS  cDNA 954 bp
   1 atgaaaatag ctatcctgac aactaatcag gtcgacgatg acaacagatt ggttgaagta    60
  61 gctcgcgcca agggacatga cgcctttctg ctcgatctgc gccaaattag tattgagttg   120
 121 ctccccagta atccagaaat ttactatcaa aatgaagtta ttacgaatca attcgatatt   180
 181 gtgatcccca gattaaatgt ttcctatacc gatttcggta tcaatatctt gcagcaattt   240
 241 atctgtgccg ggatctatgt cagcgaatcg ccagaggccc tgcgcctggg tcgggacaag   300
 301 cttaagtgtt tgcaatatct cttgagtaag gacttgccat ttccggcgac tgccattgcc   360
 361 tataccccag aatatttaga gacgctggtc ggccatctaa agttgccgct ggtggtaaag   420
 421 ttgatcgaga gcaccgaggg tactggagta tttttagcta aaactaaaaa ggaggtcgat   480
 481 aacctatgta agaccttctc tctggcaggg gttagctatc aaatacagga gtttatagcc   540
 541 gaggctgctg ggcaagatat tcgtgcgttt gtggtggggg atagggtggt ttccgcgatg   600
 601 cagagggagt cccaggacga tgattttaga gccaatgtct ctctcggtgc tcactcggcc   660
 661 gccgtgcagt tgacaccaga agaggagcag gtggtgttaa gggcgaccca aagcataggc   720
 721 gtcaatattg ctggcgtcga ctttgtgcgt tcttctcgtg ggcctctgct gctggagatc   780
 781 aatgtctccc ccgactttac cggtaaacag ggcctggaaa ccgtgactaa ctgtaatatt   840
 841 gccgccgcca tcatcgacta taccctgagt gaggccaagg gcttctatcg acatcagagg   900
 901 ttaatggcta gccgggtgcg acgggaggaa gatctgctat gtgccgatgg ctag   954
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu