LOADING...
   BC023144;RF2414A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC023144    RF2414A.SMARCA5            JCSG 421473 Plasmid Purification 10-NOV-18

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONBC023144
DESCRIPTIONBC023144 Homo sapiens SWI/SNF related, matrix associated, actin dependent regula
tor of chromatin, subfamily a, member 5, mRNA (cDNA clone MGC:17104 IMAGE:434092
1), complete cds, coding region:214-3372
ORGANISMHOMO SAPIENS
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00176; SNF2_N;
DR Pfam; PF09111; SLIDE;
DR Pfam; PF09110; HAND;
DR Pfam; PF00271; Helicase_C;
DR PDB; 3MWY; Highly similar; 29-SEP-10; CHROMO DOMAIN-CONTAINING PROTEIN 1;
DR PDB; 2NOG; Identical; 11-SEP-07; ISWI PROTEIN;
DR FFAS; 421183; Fold and function assignment.
DR TVPC; BC023144; Homologs in PDB, JCSG and SG center.
DR OVP; RF2414A.SMARCA5; Ortholog view popup.
DR TPM; BC023144; Target PDB monitor.
DR FSS; BC023144; Target function coverage.
PROPERTY Residues: 1052 aa
Molecule Weight: 121899.08 Dalton
Isoelectric Point: 8.27
Extinction Coefficient: 132700
Gravy Index: -.72
Number of Met residues: 32
Percentage of Met residues: 3.04 %
Number of Cys residues: 12
Percentage of Cys residues: 1.14 %
SEQUENCE  amino acids 1052 aa
>BC023144  BC023144 Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, su
MSSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAASAGPADAEMEE
IFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKM
KPGRPRIKKDEKQNLLSVGDYRHRRTEQEEDEELLTESSKATNVCTRFEDSPSYVKWGKL
RDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKST
LHNWMSEFKRWVPTLRSVCLIGDKEQRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKF
NWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFN
SADDFDSWFDTNNCLGDQKLVERLHMVLRPFLLRRIKADVEKSLPPKKEVKIYVGLSKMQ
REWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVT
NSGKMVVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQD
SINAYNEPNSTKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTK
TVRVFRFITDNTVEERIVERAEMKLRLDSIVIQQGRLVDQNLNKIGKDEMLQMIRHGATH
VFASKESEITDEDIDGILERGAKKTAEMNEKLSKMGESSLRNFTMDTESSVYNFEGEDYR
EKQKIAFTEWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPNVQDFQFFPPR
LFELLEKEILFYRKTIGYKVPRNPELPNAAQAQKEEQLKIDEAESLNDEELEEKEKLLTQ
GFTNWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKI
MAQIERGEARIQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLH
KLGFDKENVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLIERENMELEEKEK
AEKKKRGPKPSTQKRKMDGAPDGRGRKKKLKL

CDS  cDNA 3159 bp
   1 atgtcgtccg cggccgagcc tccgccaccc ccgcctcccg agagcgcgcc ttccaagccc    60
  61 gcagcctcga tcgccagcgg cgggagcaac agcagcaaca aaggcggccc cgaaggcgtc   120
 121 gcggcgcagg cggttgcgtc tgcggccagc gctggtcccg cagacgccga gatggaggaa   180
 181 atatttgatg atgcgtcacc tggaaagcaa aaggaaatcc aagaaccaga tcctacctat   240
 241 gaagaaaaaa tgcaaactga ccgggcaaat agattcgagt atttattaaa gcagacagaa   300
 301 ctttttgcac atttcattca acctgctgct cagaagactc caacttcacc tttgaagatg   360
 361 aaaccagggc gcccacgaat aaaaaaagat gagaagcaga acttactatc cgttggcgat   420
 421 taccgacacc gtagaacaga gcaagaggag gatgaagagc tattaacaga aagctccaaa   480
 481 gcaaccaatg tttgcactcg atttgaagac tctccatcgt atgtaaaatg gggtaaactg   540
 541 agagattatc aggtccgagg attaaactgg ctcatttctt tgtatgagaa tggcatcaat   600
 601 ggtatccttg cagatgaaat gggcctagga aagactcttc aaacaatttc tcttcttggg   660
 661 tacatgaaac attatagaaa cattcctggg cctcatatgg ttttggttcc taagtctaca   720
 721 ttacacaact ggatgagtga attcaagaga tgggtaccaa cacttagatc tgtttgtttg   780
 781 ataggagata aagaacaaag agctgctttt gtcagagacg ttttattacc gggagaatgg   840
 841 gatgtatgtg taacatctta tgaaatgctt attaaagaga agtctgtgtt caaaaaattt   900
 901 aattggagat acttagtaat agatgaagct cacaggatca aaaatgaaaa atctaagttg   960
 961 tcagaaatag tgagggaatt caagactaca aatagactat tattaactgg aacacctctt  1020
1021 cagaacaact tgcatgagct gtggtcactt cttaactttc tgttgccaga tgtgtttaat  1080
1081 tcagcagatg actttgattc ctggtttgat acaaacaact gccttgggga tcaaaaacta  1140
1141 gttgagaggc ttcatatggt tttgcgtcca ttcctccttc gtcgaattaa ggctgatgtt  1200
1201 gaaaagagtt tgcctccaaa gaaggaagta aaaatctatg tgggcctcag caaaatgcaa  1260
1261 agggaatggt atactcggat attaatgaag gatatagata tactcaactc agcaggcaag  1320
1321 atggacaaaa tgaggttatt gaacatccta atgcagttga gaaaatgttg taatcatcca  1380
1381 tatctctttg atggagcaga acctggtcca ccttatacaa cagatatgca tctagtaacc  1440
1441 aacagtggca aaatggtggt tttagacaag ctgctcccta agttaaaaga acaaggttca  1500
1501 cgagtactaa tcttcagtca aatgacaagg gtattggaca ttttggaaga ttattgcatg  1560
1561 tggagaaatt atgagtactg caggttggat ggtcagacac cccatgatga gagacaagac  1620
1621 tccatcaatg catacaatga accaaacagc acaaagtttg ttttcatgtt aagcacgcgt  1680
1681 gctggtggtc ttggcatcaa tcttgcgact gctgatgtag taattttgta tgattctgat  1740
1741 tggaatcccc aagtagatct tcaggctatg gaccgagcac atagaattgg gcagactaag  1800
1801 acagtcagag tgttccgctt tataactgat aacactgtag aagaaagaat agtagaacgt  1860
1861 gctgagatga aactcagact ggattcaata gtcattcaac aagggaggct tgtggatcag  1920
1921 aatctgaaca aaattgggaa agatgaaatg cttcaaatga ttagacatgg agcaacacat  1980
1981 gtgtttgctt caaaggaaag tgagatcact gatgaagata tcgatggtat tttggaaaga  2040
2041 ggtgcaaaga agactgcaga gatgaatgaa aagctctcca agatgggcga aagttcactt  2100
2101 agaaacttta caatggatac agagtcaagt gtttataact tcgaaggaga agactataga  2160
2161 gaaaaacaaa agattgcatt cacagagtgg attgaaccac ctaaacgaga aagaaaagcc  2220
2221 aactatgccg ttgatgcata tttcagggaa gctcttcgtg ttagtgaacc taaagcaccc  2280
2281 aaggctcctc gacctccaaa acaacccaat gttcaggatt tccagttctt tcctccacgt  2340
2341 ttatttgaat tactggaaaa agaaattctg ttttacagaa aaactattgg gtacaaggta  2400
2401 cctcgaaatc ctgagctgcc taacgcagca caggcacaaa aagaagaaca gcttaaaatt  2460
2461 gatgaagctg aatcccttaa tgatgaagag ttagaggaaa aagagaagct tctaacacag  2520
2521 ggatttacca attggaataa gagagatttt aaccagttta tcaaagctaa tgagaagtgg  2580
2581 ggtcgtgatg atattgaaaa tatagcaaga gaagtagaag gcaaaactcc agaagaagtc  2640
2641 attgaatatt cagctgtgtt ttgggaaagg tgcaacgagc tccaggacat agagaagatt  2700
2701 atggctcaga ttgaaagggg agaggcgaga attcaaagaa gaataagcat caagaaagca  2760
2761 cttgacacaa agattggacg gtacaaagca ccttttcatc agctgagaat atcatatggt  2820
2821 actaacaaag gaaaaaacta tactgaagaa gaagatcgtt ttctgatttg tatgcttcac  2880
2881 aaacttggat ttgacaaaga aaatgtttat gatgaattgc gacagtgtat tcgcaactct  2940
2941 cctcagttca gatttgactg gtttcttaag tccagaactg caatggagct ccagaggaga  3000
3001 tgtaatacct taattacttt gattgaaaga gaaaacatgg aactagaaga aaaggagaag  3060
3061 gcagagaaaa agaaacgagg accaaagcct tcaacacaga aacgtaaaat ggatggcgca  3120
3121 cctgatggtc gaggaagaaa aaagaagctg aaactatga  3159
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu