LOADING...
   BC100394;RF3866A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC100394    RF3866A.HELLS            JCSG 421236 Protein Purification 11-FEB-13

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONBC100394
DESCRIPTIONBC100394 Mus musculus helicase, lymphoid specific, mRNA (cDNA clone MGC:118052 I
MAGE:30480539), complete cds, coding region:101-2566
ORGANISMMUS MUSCULUS
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00176; SNF2_N;
DR Pfam; PF00271; Helicase_C;
DR PDB; 3MWY; Highly similar; 29-SEP-10; CHROMO DOMAIN-CONTAINING PROTEIN 1;
DR PDB; 1Z6A; Highly similar; 03-MAY-05; HELICASE OF THE SNF2/RAD54 FAMILY;
DR PDB; 1Z63; Highly similar; 17-MAY-05; 5'-D(*AP*AP*AP*AP*AP*A*AP*TP*TP*GP*CP*CP*GP*AP*AP GP*AP*AP*A;
DR FFAS; 421236; Fold and function assignment.
DR TVPC; BC100394; Homologs in PDB, JCSG and SG center.
DR OVP; RF3866A.HELLS; Ortholog view popup.
DR TPM; BC100394; Target PDB monitor.
DR FSS; BC100394; Target function coverage.
PROPERTY Residues: 821 aa
Molecule Weight: 95132.73 Dalton
Isoelectric Point: 8.2
Extinction Coefficient: 76320
Gravy Index: -.54
Number of Met residues: 27
Percentage of Met residues: 3.29 %
Number of Cys residues: 13
Percentage of Cys residues: 1.58 %
SEQUENCE  amino acids 821 aa
>BC100394  BC100394 Mus musculus helicase, lymphoid specific, mRNA (cDNA clone MGC:118052 IMAGE:30480539), comp
MAEQTEPAVITPAMLEEEEQLEAAGLEKERKMLEEAQKSWDRESTEIRYRRLQHLLEKSN
IYSKFLLTKMEQQQLEEQKKKEKLEKKKRSLKLTEGKSLVDGNGEKPVMKKKRGREDESY
NISEVMSKEEILSVAKKHKDNEDESSSTTSLCVEDIQKNKDSNSMIKDRLSQTVRQNSKF
FFDPVRKCNGQPVPFQQPKHFTGGVMRWYQVEGMEWLRMLWENGINGILADEMGLGKTVQ
CIATIALMIQRGVPGPFLVCGPLSTLPNWMAEFKRFTPEIPTLLYHGTREDRRKLVKNIH
KRQGTLQIHPVVVTSFEIAMRDQNALQHCYWKYLIVDEGHRIKNMKCRLIRELKRFNADN
KLLLTGTPLQNNLSELWSLLNFLLPDVFDDLKSFESWFDITSLSETAEDIIAKEREQNVL
HMLHQILTPFLLRRLKSDVALEVPPKREVVVYAPLCNKQEIFYTAIVNRTIANMFGSCEK
ETVELSPTGRPKRRSRRSINYSELDQFPSELEKLISQIQPEVNRERTVVEGNIPIESEVN
LKLRNIMMLLRKCCNHPYMIEYPIDPVTQEFKIDEELVTNSGKFLILDRMLPELKKRGHK
VLVFSQMTSMLDILMDYCHPRNFIFSRLDGSMSYSEREKNIYSFNTDPDVFLFLVSTRAG
GLGINLTAADTVIIYDSDWNPQSDLQAQDRCHRIGQTKPVVVYRLVTANTIDQKIVERAA
AKRKLEKLIIHKNHFKGGQSGLSQSKNFLDAKELMELLKSRDYEREVKGSREKVISDEDL
ELLLDRSDLIDQMKASRPIKGKTGIFKILENSEDSSAECLF

CDS  cDNA 2466 bp
   1 atggccgaac aaacggagcc tgcggtgatt actccagcca tgctggagga ggaggaacag    60
  61 ctcgaggctg cgggacttga gaaagagcgg aagatgttag aagaggctca aaagtcttgg   120
 121 gacagagagt ccactgaaat tcggtaccgc agacttcagc atttgcttga aaaaagcaat   180
 181 atctactcaa aatttttgtt gactaaaatg gaacaacagc aattggagga acagaagaag   240
 241 aaagagaagt tggagaaaaa aaaacggtca ttaaaactta cagagggtaa aagtttggtt   300
 301 gatgggaatg gagagaaacc agtcatgaaa aagaaaagag gaagagaaga tgaatcttat   360
 361 aatatttcag aggtcatgtc aaaagaggaa attttgtccg tagctaaaaa acataaggat   420
 421 aatgaggatg aaagctcttc cactacgagt ctttgtgtag aagatattca gaaaaataag   480
 481 gattcaaata gtatgattaa agatagattg tctcaaactg ttaggcagaa ttctaaattc   540
 541 ttttttgacc cagttcggaa atgtaacgga cagcctgtac cctttcaaca accaaagcat   600
 601 ttcacaggag gagtaatgag gtggtaccaa gtagaaggca tggaatggct taggatgctt   660
 661 tgggaaaatg gaattaatgg cattttagca gatgaaatgg gtttgggaaa gactgttcag   720
 721 tgcattgcta caattgcatt gatgattcag aggggagtac ctggaccttt tcttgtttgt   780
 781 ggccctttgt ctacacttcc taactggatg gctgaattta aaagatttac tccagaaatt   840
 841 cctactctgc tgtatcatgg aacccgggag gaccgtcgga aattagtaaa gaatatccac   900
 901 aaaagacaag ggacactgca gattcatcct gtggtggtca catcattcga gatcgctatg   960
 961 cgagaccaga atgctttaca gcattgctat tggaaatact taatagtaga tgaaggacac  1020
1021 aggattaaga atatgaagtg ccggctaatc agggagttaa aacggttcaa tgctgataac  1080
1081 aaacttcttt tgactggtac tcccttgcaa aacaatttat cagaactttg gtcattgcta  1140
1141 aactttttgt tgccagatgt atttgatgac ttgaaaagct ttgagtcttg gtttgacatc  1200
1201 actagtcttt ctgaaactgc tgaagatatt atagctaaag agagagaaca gaatgtttta  1260
1261 catatgctgc accagatttt aacgcctttc ctactgagaa gactgaagtc tgatgttgct  1320
1321 cttgaagtcc cccctaagcg agaagtagtt gtttatgcac cactttgcaa taaacaagag  1380
1381 atcttctata cagctattgt gaaccgcaca attgcaaaca tgtttggatc ctgtgagaag  1440
1441 gaaacagttg agctaagtcc tactggaaga ccaaaacgac gaagtagaag gtcaataaat  1500
1501 tacagcgaac tagatcagtt ccctagtgaa ttagaaaaac taataagtca aatacagcca  1560
1561 gaagtaaaca gagagaggac tgttgtggaa ggtaatatcc ctatagaatc tgaagttaat  1620
1621 ctgaagctgc ggaatataat gatgctactt cgaaagtgct gtaatcaccc atatatgatt  1680
1681 gaatatccta ttgaccctgt cacacaagaa tttaagattg atgaagagtt ggtaacaaat  1740
1741 tctgggaagt tcttaatttt ggatcgaatg ctgcccgaac ttaaaaaaag aggtcacaag  1800
1801 gttctggtgt tttcacaaat gacaagcatg ttggacatct tgatggatta ttgccatcct  1860
1861 agaaacttca tctttagcag acttgatggg tccatgtctt attcggaaag agaaaaaaat  1920
1921 atatacagtt tcaacacgga tccagatgtt tttcttttct tagtgagtac acgagcaggt  1980
1981 ggtttaggca taaacttgac tgcagcagat acagtgatca tttatgacag tgattggaat  2040
2041 cctcagtctg atctccaggc tcaagataga tgtcatagaa ttggtcagac aaagccagtt  2100
2101 gttgtgtatc gtcttgtaac agcaaatact attgaccaga aaattgtgga aagagcagct  2160
2161 gctaaaagaa agttggagaa gttgataatc cataaaaatc atttcaaagg tggtcagtct  2220
2221 gggttaagtc aatctaagaa tttcttagat gcaaaggaat taatggagtt attaaaatct  2280
2281 agagattatg aaagggaagt aaaaggatcc agagagaagg tcattagtga cgaagatcta  2340
2341 gaattactgt tggatcgaag tgatctcatt gatcaaatga aggcttcaag accaattaaa  2400
2401 gggaagacag ggatattcaa aatactagaa aattctgaag attccagtgc tgaatgttta  2460
2461 ttttaa  2466
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu