LOADING...
   NP_813369.1;RK10653A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_813369.1    RK10653A            JCSG 375199 PDB Deposition 10-MAR-25              PDB id: 3mbj, 3mbh

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_813369.1
DESCRIPTIONPutative phosphomethylpyrimidine kinase
ORGANISMBacteroides thetaiotaomicron vpi-5482
COMMENT 
DR UNIPROT; Q89ZB9_BACTN
DR SPTR;
DR GenBank; NP_813369
DR PDB; 3MBJ; Identical; 12-MAY-10; PUTATIVE PHOSPHOMETHYLPYRIMIDINE KINASE;
DR PDB; 3MBH; Identical; 02-JUN-10; PUTATIVE PHOSPHOMETHYLPYRIMIDINE KINASE;
DR PDB; 3H74; Highly similar; 26-MAY-09; PYRIDOXAL KINASE;
DR PDB; 3HYO; Highly similar; 30-JUN-09; PYRIDOXAL KINASE;
DR PDB; 3IBQ; Highly similar; 28-JUL-09; PYRIDOXAL KINASE;
DR KEGG; 2.7.4.7; Enzyme page
DR FFAS; 375199; Fold and function assignment.
DR TVPC; NP_813369.1; Homologs in PDB, JCSG and SG center.
DR OVP; RK10653A; Ortholog view popup.
DR TPM; NP_813369.1; Target PDB monitor.
DR FSS; NP_813369.1; Target function coverage.
PROPERTY Residues: 290 aa
Molecule Weight: 32825.03 Dalton
Isoelectric Point: 5.17
Extinction Coefficient: 34840
Gravy Index: -.12
Number of Met residues: 11
Percentage of Met residues: 3.79 %
Number of Cys residues: 2
Percentage of Cys residues: 0.69 %
SEQUENCE  amino acids 290 aa
>NP_813369.1  gi|29349866|ref|NP_813369.1| pyridoxine kinase [Bacteroides thetaiotaomicron VPI-5482]
MYANKVKKIAAVHDLSGMGRVSLTVVIPILSSMGFQVCPLPTAVLSNHTQYPGFSFLDLT
DEMPKIIAEWKKLEVQFDAIYTGYLGSPRQIQIVSDFIKDFRQPDSLIVADPVLGDNGRL
YTNFDMEMVKEMRHLITKADVITPNLTELFYLLDEPYKADSTDEELKEYLRLLSDKGPQV
VIITSVPVHDEPHKTSVYAYNRQGNRYWKVTCPYLPAHYPGTGDTFTSVITGSLMQGDSL
PMALDRATQFILQGIRATFGYEYDNREGILLEKVLHNLDMPIQMASYELI

CDS  cDNA 873 bp
   1 atgtatgcaa ataaagtaaa gaagatagct gccgttcatg acctttcggg gatgggacgt    60
  61 gtttctctga cagtcgttat tcctatctta tcctctatgg gttttcaggt ttgtccgctt   120
 121 cctacggcgg tattgtccaa ccatacgcag tatcccggct tctcctttct ggacctgacg   180
 181 gatgaaatgc cgaagatcat agccgaatgg aagaagctgg aagttcagtt tgacgctatt   240
 241 tataccggtt atctgggttc cccgcggcag attcagattg tttccgattt catcaaggat   300
 301 ttccgtcagc cggatagtct gatagtagcc gatccggtgc tgggtgataa cggccggctt   360
 361 tataccaact ttgatatgga gatggtgaaa gaaatgcgtc atctgataac caaagcggat   420
 421 gtgatcacac cgaatctgac agaactgttt tatttgctgg acgaaccgta taaagcggat   480
 481 agtacggatg aggaactgaa agaatatctc cgtctcctgt ccgataaagg tccacaggtg   540
 541 gttattatca ccagtgttcc ggtgcacgat gagcctcata agacttccgt atatgcctac   600
 601 aatcgtcagg gaaaccgcta ctggaaagtg acttgccctt atctgcctgc ccactatccg   660
 661 ggcacagggg atacattcac aagtgtgatc accggctcct tgatgcaggg agacagtctt   720
 721 ccgatggcgt tggaccgtgc tacccagttt attctgcaag ggattcgggc aacctttggc   780
 781 tatgagtatg acaaccggga aggtattttg ctggaaaaag tgcttcataa tctggatatg   840
 841 ccgatacaaa tggcaagcta tgagttgata taa   873
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
5868241 5869113 1 Glimmer3 score 11.37 poor
Genemark probabilities .91   .88 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu