LOADING...
   YP_441931.1;YP_441931.1
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_441931.1    SC.B20993D            JCSG 428743 Proposed Target 13-JAN-04

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_441931.1
DESCRIPTIONgi|83719443|ref|YP_441931.1| hypothetical protein BTH_I1385 [Burkholderia thaila
ndensis E264]
ORGANISMBurkholderia thailandensis E264
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR FFAS; 428743; Fold and function assignment.
DR TVPC; YP_441931.1; Homologs in PDB, JCSG and SG center.
DR OVP; SC.B20993D; Ortholog view popup.
DR TPM; YP_441931.1; Target PDB monitor.
DR FSS; YP_441931.1; Target function coverage.
PROPERTY Residues: 168 aa
Molecule Weight: 18488.3 Dalton
Isoelectric Point: 11.5
Extinction Coefficient: 26470
Gravy Index: -.21
Number of Met residues: 3
Percentage of Met residues: 1.79 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 168 aa
>YP_441931.1  gi|83719443|ref|YP_441931.1| hypothetical protein BTH_I1385 [Burkholderia thailandensis E264]
MAAFSLFSPISRRRAMSHSVPEQRFHTASQKRHMSAAQYRALRKELLILRSDVERLELAQ
AGAELRQSVTHFKWLKLLVPGVSGGSLGKSARNVNATLGALVSQYPLLSSLASVALAKPV
RALLRASARPALKWGAVGFAVWEAYQIWRQAKNSDGASDAEARQRTRP

CDS  cDNA 507 bp
   1 gtggcagcgt tctccctctt ctcgcccatt tctcgtcgac gcgccatgag tcactccgtt    60
  61 ccggaacaac gattccacac cgcttcgcaa aagcggcaca tgagcgcggc ccagtaccgc   120
 121 gcgctgcgca aggaactgct gatcctgcgc tccgacgtcg agcgcctcga actcgcgcaa   180
 181 gcgggcgccg agctgcgcca gtccgtcacg catttcaagt ggttgaagct cctcgtgcct   240
 241 ggggtatcgg gcggatcgct cggcaagtcg gcgagaaacg tgaacgcgac gctcggcgcg   300
 301 ctcgtcagcc agtatccgct attgagctcg ctcgcgtcgg tcgcgctcgc gaagcccgtg   360
 361 cgcgcgctgt tgcgcgcgag cgcacgcccg gcgctcaaat ggggcgccgt cggcttcgcg   420
 421 gtttgggagg cctaccagat ctggaggcag gcgaagaaca gcgacggcgc atccgacgcc   480
 481 gaggctcggc aacgcacacg cccatga   507
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1560523 1561029 -1 Glimmer3 score - -
Genemark probabilities .71   - poor
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu