LOADING...
   YP_094066.1;SP14202AG
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_094066.1    SP14202AG            JCSG 418709 Scaling 13-JUL-22

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_094066.1
DESCRIPTIONgi|52840267|ref|YP_094066.1| thiol-disulfide oxidoreductase ResA [Legionella pne
umophila subsp. pneumophila str. Philadelphia 1]
ORGANISMLEGIONELLA PNEUMOPHILA SUBSP. PNEUMOPHILA STR. PHILADELPHIA 1
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00578; AhpC-TSA;
DR Pfam; PF08534; Redoxin;
DR PDB; 1ST9; Highly similar; 11-MAY-04; THIOL-DISULFIDE OXIDOREDUCTASE RESA;
DR PDB; 1SU9; Highly similar; 11-MAY-04; THIOL-DISULFIDE OXIDOREDUCTASE RESA;
DR PDB; 2H1D; Highly similar; 19-SEP-06; THIOL-DISULFIDE OXIDOREDUCTASE RESA;
DR PDB; 2F9S; Highly similar; 18-APR-06; THIOL-DISULFIDE OXIDOREDUCTASE RESA;
DR PDB; 3C73; Highly similar; 12-AUG-08; THIOL-DISULFIDE OXIDOREDUCTASE RESA;
DR PDB; 2H1B; Highly similar; 19-SEP-06; THIOL-DISULFIDE OXIDOREDUCTASE RESA;
DR PDB; 2H19; Highly similar; 19-SEP-06; THIOL-DISULFIDE OXIDOREDUCTASE RESA;
DR PDB; 2H1A; Highly similar; 19-SEP-06; THIOL-DISULFIDE OXIDOREDUCTASE RESA;
DR FFAS; 412119; Fold and function assignment.
DR TVPC; YP_094066.1; Homologs in PDB, JCSG and SG center.
DR OVP; SP14202AG; Ortholog view popup.
DR TPM; YP_094066.1; Target PDB monitor.
DR FSS; YP_094066.1; Target function coverage.
PROPERTY Residues: 156 aa
Molecule Weight: 17834.85 Dalton
Isoelectric Point: 9
Extinction Coefficient: 26930
Gravy Index: -.09
Number of Met residues: 1
Percentage of Met residues: 0.64 %
Number of Cys residues: 2
Percentage of Cys residues: 1.28 %
SEQUENCE  amino acids 156 aa
>YP_094066.1  gi|52840267|ref|YP_094066.1| thiol-disulfide oxidoreductase ResA [Legionella pneumophila subsp. pneu
MKRLIPTFIYLLVLAITPFSTHAEALLKDTFGHNIPFSSLKGKWVFINYWASWCETCVDE
IPEFNRFYKNHKNEAVALYAVNYDALPLPEQKLLIKKFNINYPNLLKDPAQDLQLGDITG
VPVTFVFNPKGQLIKKLYGGQTAKTLEKVIAENRTS

CDS  cDNA 471 bp
   1 atgaagcgct taatacctac tttcatatac ctgctggttt tagcaattac tcccttctct    60
  61 actcatgcag aagcgctttt gaaagacact tttggtcaca atattccttt ttcatcactt   120
 121 aaaggaaaat gggtttttat caactattgg gcaagctggt gtgaaacctg tgtcgatgaa   180
 181 atccctgaat ttaatcgctt ttacaaaaac cataaaaatg aggcagtagc cctatacgca   240
 241 gtcaattacg atgctcttcc cttaccagag caaaaattac taattaaaaa atttaatatt   300
 301 aactacccta atttgttaaa ggatccggct caggatttac aattaggaga catcacagga   360
 361 gtgcctgtaa cttttgtatt taacccaaaa gggcaattaa ttaaaaaatt atacggggga   420
 421 caaacggcaa aaacattaga aaaagtcatt gcagagaaca ggacctccta a   471
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu