LOADING...
   ZP_02066110.1;SP16541B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02066110.1    SP16541B            JCSG 416729 PDB Deposition 11-NOV-22              PDB id: 3urz

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02066110.1
DESCRIPTIONPutative protein binding protein, TPR-domain containing protein, divergent member of PFAM PF07719
ORGANISMBacteroides ovatus
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 3URZ; Identical; 14-DEC-11; UNCHARACTERIZED PROTEIN;
DR FFAS; 408077; Fold and function assignment.
DR TVPC; ZP_02066110.1; Homologs in PDB, JCSG and SG center.
DR OVP; SP16541B; Ortholog view popup.
DR TPM; ZP_02066110.1; Target PDB monitor.
DR FSS; ZP_02066110.1; Target function coverage.
PROPERTY Residues: 227 aa
Molecule Weight: 26423.07 Dalton
Isoelectric Point: 9.12
Extinction Coefficient: 27850
Gravy Index: -.47
Number of Met residues: 6
Percentage of Met residues: 2.64 %
Number of Cys residues: 3
Percentage of Cys residues: 1.32 %
SEQUENCE  amino acids 227 aa
>ZP_02066110.1  gi|160885107|ref|ZP_02066110.1| hypothetical protein BACOVA_03105 [Bacteroides ovatus ATCC 8483]
MRTLTIFLISLFLLPLVLNAQSVDEMLQKVSAAIEAGQNGQAVSYFRQTIALNIDRTEMY
YWTNVDKNSEISSKLATELALAYKKNRNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCR
GQEKDALRMYEKILQLEADNLAANIFLGNYYYLTAEQEKKKLETDYKKLSSPTKMQYARY
RDGLSKLFTTRYEKARNSLQKVILRFPSTEAQKTLDKILRIEKEVNR

CDS  cDNA 684 bp
   1 atgaggacct taactatttt tcttatctct ttatttttat tgccgctggt gctgaatgcg    60
  61 cagtcggttg atgagatgtt acaaaaagtg tctgctgcca ttgaggcagg gcagaatggg   120
 121 caggctgtga gctatttccg gcagactatc gctctgaata tagaccgtac ggaaatgtat   180
 181 tattggacga atgtagacaa gaacagtgaa attagctcca aactggctac agaattagcg   240
 241 cttgcctata aaaagaatcg gaattacgac aaagcctatt tattttacaa ggaattactg   300
 301 caaaaggctc ctaataatgt agattgtttg gaagcttgcg cagaaatgca ggtatgtcgc   360
 361 gggcaggaga aagatgcttt gcgtatgtac gaaaaaatat tgcaacttga ggcggataat   420
 421 ctggcggcta atatcttttt aggaaactat tattatttga cagcagaaca ggagaaaaaa   480
 481 aagttagaga cggattataa aaaactttct tctcccacta aaatgcagta tgcccgctac   540
 541 cgggatggat tatcgaagtt atttactacc cggtatgaga aagcgcgtaa ctctttgcag   600
 601 aaagtgattc tgcgtttccc atcaacagaa gctcaaaaga cattggataa gatattgagg   660
 661 atagaaaaag aggtgaatcg ctaa   684
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu