LOADING...
   ZP_02071203.1;SP16664C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02071203.1    SP16664C            JCSG 409191 Proposed Target 09-NOV-12

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02071203.1
DESCRIPTIONgi|160890200|ref|ZP_02071203.1| hypothetical protein BACUNI_02640 [Bacteroides u
niformis ATCC 8492]
ORGANISMBacteroides uniformis
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF08522; DUF1735;
DR PDB; 3POH; Highly similar; 29-DEC-10; ENDO-BETA-N-ACETYLGLUCOSAMINIDASE F1;
DR FFAS; 409191; Fold and function assignment.
DR TVPC; ZP_02071203.1; Homologs in PDB, JCSG and SG center.
DR OVP; SP16664C; Ortholog view popup.
DR TPM; ZP_02071203.1; Target PDB monitor.
DR FSS; ZP_02071203.1; Target function coverage.
PROPERTY Residues: 660 aa
Molecule Weight: 73969 Dalton
Isoelectric Point: 4.8
Extinction Coefficient: 133510
Gravy Index: -.44
Number of Met residues: 17
Percentage of Met residues: 2.58 %
Number of Cys residues: 7
Percentage of Cys residues: 1.06 %
SEQUENCE  amino acids 660 aa
>ZP_02071203.1  gi|160890200|ref|ZP_02071203.1| hypothetical protein BACUNI_02640 [Bacteroides uniformis ATCC 8492]
MKYMNHVKSGLLAMAFACAGICFTGCEDDVVINTGNSDKLDTVDGVYGYVKSAAGARELT
PISVFGDKVATGHLYFELSKAAEQDVTVTFKVDEDVLEAYNKKNGTSYKMYPADKLSLAN
GGTATIKAGEQKSASVELNINAGGTIGQTYAVAVSASANNGVEVSTNNQEYIYLVKPLAA
IPESISKGDILTHCFVEVNDENILNMGEYTMKSDGKPFFDVVSIFAANINVDSKTGRVHV
FCNDQVSFLLRNADKFIRPLQAKGIKVVMTILGNHDEAGMGNLSEAAAKDFAKELKAYLD
IYGLDGIDFDDEYTSYNNSNPSPGFEKRSRANFARLVYECRQVFGKKLIGVYEYGSLDSP
DGEVEGVKVGDIVDYMTYGYYQNQNPNGAFGREESHFENLPKSKYAPLPWKINDELNGGW
SGFDKSKFQKVKDEGYGIQMFYNPKPLMYQYYVLLSEISEVLFDDGVEWSGKYWSRTGEA
YQGKMLGYEDLVGEWKVTSSNSLFTYVDEEGNPRWWDWKGSQEFEKNVIIEKDEEGTGYV
VYNWGTFPEITGKYPMHCDYYNGALLIYPQTIHEGDAEDPATYKMHFGTYSKNFQWKAYP
NYDDYYMDGAIAPNGDMHIYGLGNRWAINPYKYVGGEIETDIFPDVPYFVSENYTMKKVR

CDS  cDNA 1983 bp
   1 atgaaatata tgaatcatgt aaaatcaggc ttgctggcaa tggcctttgc atgtgcagga    60
  61 atatgcttta ccggttgtga agatgatgtt gtcatcaaca ccggcaacag tgacaagctg   120
 121 gatactgtgg atggcgtgta tggctatgta aagtctgccg ccggtgcacg tgaacttact   180
 181 ccgatttctg tttttggcga caaggttgct accggacatc tctattttga actgagcaaa   240
 241 gctgcagagc aggatgttac tgtgaccttc aaagtggacg aagacgtttt ggaggcttac   300
 301 aataagaaga atggaacaag ctataaaatg tatcccgccg ataagctgag tttggcgaac   360
 361 ggtggaactg ccactatcaa ggcgggcgaa cagaagtcgg cttctgtgga actgaatatc   420
 421 aatgccggag gcacaatcgg acagacttat gctgttgccg tttctgcatc tgccaataac   480
 481 ggtgtggaag tttctacaaa caatcaggaa tatatttact tggtaaagcc tttggctgct   540
 541 attcctgaga gtatcagtaa gggtgatata cttacacatt gctttgtgga agtaaatgac   600
 601 gagaacatct tgaatatggg tgaatatact atgaagagcg acggaaagcc tttctttgat   660
 661 gttgtcagca tttttgcagc taacatcaat gtggatagca agactggtcg cgttcatgtt   720
 721 ttctgcaatg accaggtttc tttcttgctg agaaatgcgg ataagttcat ccgtcctttg   780
 781 caggctaaag gcattaaggt ggtgatgact attcttggta accatgacga ggcaggtatg   840
 841 ggcaaccttt cggaagctgc tgccaaagac tttgctaagg aactgaaagc ctacttggat   900
 901 atttatggtt tggatggcat tgactttgat gatgagtaca ccagttataa taactccaat   960
 961 cccagtcccg gcttcgaaaa acgttcacgt gccaacttcg cgcgcttggt ttacgaatgc  1020
1021 cgccaagtgt ttggcaaaaa gttgattggt gtgtatgaat atggttctct cgactctccc  1080
1081 gacggcgagg tagaaggtgt gaaagtaggt gatattgtgg attatatgac ctacggttat  1140
1141 taccagaatc agaatcctaa tggagccttt ggccgtgaag agtctcattt tgagaacctg  1200
1201 cccaaatcca agtatgctcc gttaccctgg aagattaatg atgagctgaa cggaggctgg  1260
1261 agcggatttg acaaaagcaa attccaaaaa gtgaaggatg aaggttatgg tattcagatg  1320
1321 ttctacaacc ccaaaccact gatgtatcag tattacgtgt tgctttcgga aataagtgag  1380
1381 gtgctctttg atgatggagt ggaatggagt ggcaagtact ggagccgtac cggtgaagct  1440
1441 tatcagggca aaatgttggg ttatgaagat ttggtcggcg agtggaaggt aacttccagc  1500
1501 aattccctct ttacctatgt ggatgaagaa ggtaatcctc gctggtggga ttggaaaggc  1560
1561 agtcaggagt ttgagaagaa tgtaattata gagaaggatg aagaaggtac cggatatgtg  1620
1621 gtttacaact ggggtacttt ccccgaaatc accggtaagt atccgatgca ttgcgattac  1680
1681 tataacggtg cactgctcat ctatccgcaa accattcatg agggcgatgc tgaagaccct  1740
1741 gctacctaca agatgcattt cggtacttac agcaagaatt tccagtggaa agcatatcct  1800
1801 aactatgatg attactatat ggatggtgct attgctccta acggtgatat gcatatctat  1860
1861 ggcttaggca acagatgggc tatcaatccc tataagtatg taggcggtga gattgagacc  1920
1921 gacatcttcc ccgatgttcc ttacttcgtg agtgagaact atacgatgaa gaaggtacgc  1980
1981 tga  1983
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu