LOADING...
   YP_001303840.1;SP16877B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001303840.1    SP16877B            JCSG 412644 Proposed Target 09-NOV-12

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001303840.1
DESCRIPTIONgi|150009097|ref|YP_001303840.1| hypothetical protein BDI_2498 [Parabacteroides
distasonis ATCC 8503]
ORGANISMParabacteroides distasonis ATCC 8503
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR FFAS; 412644; Fold and function assignment.
DR TVPC; YP_001303840.1; Homologs in PDB, JCSG and SG center.
DR OVP; SP16877B; Ortholog view popup.
DR TPM; YP_001303840.1; Target PDB monitor.
DR FSS; YP_001303840.1; Target function coverage.
PROPERTY Residues: 776 aa
Molecule Weight: 82237.91 Dalton
Isoelectric Point: 4.65
Extinction Coefficient: 43210
Gravy Index: -.2
Number of Met residues: 16
Percentage of Met residues: 2.06 %
Number of Cys residues: 3
Percentage of Cys residues: 0.39 %
SEQUENCE  amino acids 776 aa
>YP_001303840.1  gi|150009097|ref|YP_001303840.1| hypothetical protein BDI_2498 [Parabacteroides distasonis ATCC 8503
MRTITKLQTLLVLFLTTAMVCFMGCKDDDDDVPTPDGGGTVATYAISGTVMDASNNPMAG
VSVALSGAQSLSATTGSDGTYSFDLKSTPGSYKIAFKSEGYADRSYDVDVKKIESGVGQY
VVNAVMVKGTTPDTPKEYKKAKYNLSVSIEDVVGKAISTSSLSVVVKYGDKEIAKENKPN
FKVSDVTPGIYDVVATASGYTKAVAKVVVSAVPDQEKKEGEGDTFDVEYPAIIVMNVAPS
IPVDPDDPSKPTDPSDPSDPSKPTDPSDPSDPSKPTDPLKATYIVSGIITDLSTGADIKT
AEVILMLGSEELFISKNESEFSFNIASSKVTEDAQFILSVKAAGYTSYSRTIIFKVGQSM
NYVFPITLNPIGTGGNTEIDFSKYGVQVPEKEAEKVADEIKNAINAGGTEEVKVSGVTYV
DENNVEQKVDVVIPANVLDNYKGADNEVQAPVIKVLNQSDAEKLTESIGVIESTTADGIK
EKDEVSLVAESGKPVVIVMPASSNQTLVIERDMSAEALQSNNVTSDAGAVASVSRVYKGE
PSGTVFSPALKISFDAPKDLVSSTQPMALLYATTGIDNKEIMKIDPTADPVYINGTGAEM
SVAHFSKFAAGFELALAETEDISTDTTIVEKVVDYCSDGKAGNIPVVVTTTNAYVGENLQ
DLVGKSNVDGQVAKNAVYNRISNRLQADGYQIGIQTSLTTSVPTEADRTVASMSLKKTYT
TNTYVFKFMTKGKKVEEIQVVAKKLIKIEGTPVYKQSHGHGHGDGNNAGGGIIIPD

CDS  cDNA 2331 bp
   1 atgagaacaa ttacaaagtt acagacctta ttggtcttgt tccttacgac agccatggta    60
  61 tgtttcatgg gctgtaagga tgacgatgat gatgtgccta ctccggatgg tggtggcact   120
 121 gttgccacct atgcgattag tggtacggtc atggatgcca gtaacaaccc gatggctggc   180
 181 gttagcgtag ctctttctgg agctcaatct cttagtgcta cgacgggttc tgatggaacg   240
 241 tactctttcg acttgaaaag cacaccaggc tcttacaaaa tcgcctttaa gtcggaaggc   300
 301 tatgcagaca gaagctatga tgtggatgtg aagaagatcg aatcgggtgt tggacagtat   360
 361 gtagtaaacg ccgtcatggt aaagggcacg actcccgata ctccgaaaga gtataagaag   420
 421 gcgaagtaca atctttccgt atcgatcgag gatgttgtgg gaaaagctat ctctacttcc   480
 481 agcctttctg ttgtcgtaaa atacggggat aaagagatcg ctaaagagaa taaacctaat   540
 541 tttaaggtct ctgatgtgac tcccggtatc tacgacgtag tagctacagc ttccggatat   600
 601 actaaagccg tggctaaggt tgtcgtttca gccgttccgg atcaagaaaa gaaagagggc   660
 661 gaaggtgata cattcgacgt tgagtatcca gctattatcg tgatgaatgt cgctccttct   720
 721 attccagtag acccggatga tccttctaag ccgacagatc cttctgaccc gtctgatcct   780
 781 tccaagccaa cagacccgtc tgatccttcc gatccttcca aaccgacaga tccgttaaaa   840
 841 gcgacttata tcgtatctgg tataataaca gacctatcta cgggcgcaga catcaaaact   900
 901 gcggaagtca tattgatgtt aggaagtgaa gagttattta tttctaagaa tgagagtgag   960
 961 ttctctttca atatcgcatc atcaaaggtt acggaggatg ctcaatttat cttgagtgtt  1020
1021 aaagccgcag gttatacgag ctactctcgt acgatcatct ttaaggtcgg tcagagtatg  1080
1081 aactatgtat ttcctatcac attgaaccct ataggtacag gtggaaatac ggagattgat  1140
1141 ttttctaaat atggtgttca ggttccggaa aaagaagcgg aaaaagtagc ggatgagatt  1200
1201 aagaatgcga ttaacgcagg cggaaccgaa gaggttaagg tgtctggtgt cacttatgtg  1260
1261 gatgagaata atgttgaaca aaaagtagac gttgtcattc ctgctaatgt cttagataac  1320
1321 tataaaggtg cggataatga ggttcaagct ccagttatta aggtcttgaa tcaaagtgat  1380
1381 gctgagaaat tgacagaatc gataggagtg attgaaagta cgaccgctga tggtataaaa  1440
1441 gagaaagatg aggtaagttt ggtcgcggaa agtggtaagc ctgtcgttat cgttatgccg  1500
1501 gcaagtagta atcaaacatt ggtgatcgaa cgtgatatgt ctgcggaagc tctgcaatcc  1560
1561 aataatgtga cttctgatgc tggtgcggta gccagtgtaa gccgtgtata taaaggcgag  1620
1621 cctagcggta cggtattctc tccggctttg aagatctcgt tcgacgctcc gaaggatttg  1680
1681 gtttcttcta cacagcctat ggcattgtta tatgcgacca caggcataga taataaggag  1740
1741 atcatgaaga ttgatcctac ggcggaccct gtttatatca atggtactgg tgcggaaatg  1800
1801 tctgtcgctc acttctctaa gtttgccgca ggttttgagt tggcattagc ggaaactgaa  1860
1861 gatatcagta ctgatactac aatcgtagaa aaggttgttg attactgttc tgatggtaag  1920
1921 gcaggaaaca ttcctgtagt tgttacaact acaaatgctt atgttggaga aaacttgcag  1980
1981 gatctagtcg gaaaatctaa cgtagatggt caagtcgcta agaatgcggt ttataaccga  2040
2041 atctctaatc gtttgcaagc tgatggttat cagataggta tccaaacatc attgacaaca  2100
2101 tccgttccta cggaagctga tcgtacggtc gcttctatga gcttgaagaa gacatatact  2160
2161 acaaatacgt atgtatttaa gtttatgaca aagggtaaga aggtggaaga gattcaggtt  2220
2221 gtagctaaaa aacttatcaa gatagaaggt actcctgttt acaagcaatc ccatggtcac  2280
2281 ggacatggtg atggcaataa cgccggtggc ggtatcatca tcccggatta a  2331
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu