LOADING...
   ZP_02072989.1;SP17015A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02072989.1    SP17015A            JCSG 417983 Protein Purification 11-NOV-03

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02072989.1
DESCRIPTIONgi|160891986|ref|ZP_02072989.1| hypothetical protein BACUNI_04445 [Bacteroides u
niformis ATCC 8492]
ORGANISMBacteroides uniformis
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR FFAS; 409525; Fold and function assignment.
DR TVPC; ZP_02072989.1; Homologs in PDB, JCSG and SG center.
DR OVP; SP17015A; Ortholog view popup.
DR TPM; ZP_02072989.1; Target PDB monitor.
DR FSS; ZP_02072989.1; Target function coverage.
PROPERTY Residues: 129 aa
Molecule Weight: 14507.94 Dalton
Isoelectric Point: 8.85
Extinction Coefficient: 30480
Gravy Index: -.19
Number of Met residues: 3
Percentage of Met residues: 2.33 %
Number of Cys residues: 1
Percentage of Cys residues: 0.78 %
SEQUENCE  amino acids 129 aa
>ZP_02072989.1  gi|160891986|ref|ZP_02072989.1| hypothetical protein BACUNI_04445 [Bacteroides uniformis ATCC 8492]
MKVTKILIAMLASAFIVTACDPIEDEDLRDKYVTDAGTPITKEALQAAISITQPFPNQDG
VVEGDQYIALKNSRPDIGGSWHIEWGAKEVNKVRLWSRTTLRSSWSPMRTIPSTIWAFPP
IRLSRQIRL

CDS  cDNA 390 bp
   1 atgaaagtaa caaaaatatt gatagcaatg cttgcttcag ccttcatcgt tactgcatgc    60
  61 gatcctatcg aagacgaaga cttgcgagac aaatatgtga ctgatgccgg tacacccata   120
 121 accaaggagg cattacaagc cgccatatcc attacccaac ccttccccaa ccaagacgga   180
 181 gtagtggaag gcgaccagta tatcgccctg aaaaactccc gcccggacat tggcggttca   240
 241 tggcacatag aatggggggc gaaggaagta aacaaagtaa gactctggtc acggacaacg   300
 301 ctacggtcat catggagtcc aatgcggact attccatcta ctatatgggc atttccgcca   360
 361 atcagattat caagacagat ccggttgtag   390
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu