LOADING...
   YP_976050.1;SP17614A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_976050.1    SP17614A            JCSG 418890 Protein Purification 13-JUL-18

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_976050.1
DESCRIPTIONgi|121635805|ref|YP_976050.1| putative periplasmic protein [Neisseria meningitid
is FAM18]
ORGANISMNEISSERIA MENINGITIDIS FAM18
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR FFAS; 412346; Fold and function assignment.
DR TVPC; YP_976050.1; Homologs in PDB, JCSG and SG center.
DR OVP; SP17614A; Ortholog view popup.
DR TPM; YP_976050.1; Target PDB monitor.
DR FSS; YP_976050.1; Target function coverage.
PROPERTY Residues: 132 aa
Molecule Weight: 14654.11 Dalton
Isoelectric Point: 9.69
Extinction Coefficient: 15470
Gravy Index: -.29
Number of Met residues: 6
Percentage of Met residues: 4.55 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 132 aa
>YP_976050.1  gi|121635805|ref|YP_976050.1| putative periplasmic protein [Neisseria meningitidis FAM18]
MMPSDVGIRLQTAFKRKLKMKKIFYFLMVVFSTSVWAGDAEDNLLSIQSGYRALLQKQNN
LDGKIIGMQSDLEDARRRLQAAQADIARLEAEIPAAMAQKARQAEELRQIGVRLDHAWNA
VYGAGGTKASGN

CDS  cDNA 399 bp
   1 gtgatgccgt ctgatgttgg aatacggctt cagacggcat ttaaacggaa gttaaaaatg    60
  61 aaaaaaatat tttattttct gatggttgtt ttttctacaa gcgtatgggc cggggatgcg   120
 121 gaagacaatc tgctcagcat ccaatccggt tatcgtgcct tactgcaaaa acaaaacaat   180
 181 ctggacggaa aaatcatcgg gatgcagtcg gatttggaag atgcgcgcag acggttgcag   240
 241 gcggctcagg cagacatcgc ccgtttggaa gcggaaattc ctgcagcaat ggcgcaaaaa   300
 301 gcccggcagg ctgaagagct gaggcaaatc ggagtgcgtt tggaccatgc ttggaatgcg   360
 361 gtttacggcg cagggggaac gaaagcgtcg gggaattga   399
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu