LOADING...
   ZP_02423296.1;SP17764A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02423296.1    SP17764A            JCSG 420650 Protein Purification 10-NOV-20

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02423296.1
DESCRIPTIONgi|167751169|ref|ZP_02423296.1| hypothetical protein EUBSIR_02155 [Eubacterium s
iraeum DSM 15702]
ORGANISMEubacterium siraeum DSM 15702
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR FFAS; 411222; Fold and function assignment.
DR TVPC; ZP_02423296.1; Homologs in PDB, JCSG and SG center.
DR OVP; SP17764A; Ortholog view popup.
DR TPM; ZP_02423296.1; Target PDB monitor.
DR FSS; ZP_02423296.1; Target function coverage.
PROPERTY Residues: 429 aa
Molecule Weight: 46660.8 Dalton
Isoelectric Point: 9.23
Extinction Coefficient: 79190
Gravy Index: -.34
Number of Met residues: 10
Percentage of Met residues: 2.33 %
Number of Cys residues: 4
Percentage of Cys residues: 0.93 %
SEQUENCE  amino acids 429 aa
>ZP_02423296.1  gi|167751169|ref|ZP_02423296.1| hypothetical protein EUBSIR_02155 [Eubacterium siraeum DSM 15702]
MKNKLRKMLSLVLAVVIAMSAISVNTLAATRMNIANGSNQKLYVDWYGYSYNFNGRLNTS
TYGQIIKLNVGSSTGQVAYCIQSSKDAWTGDYTAQDYYDDLSRAQKLNLKHALIYGYQGT
TNYGYNADTERIATQIVIWNICDGWFNNFAESTAVGIFTEGMSSSMATNVKACYNKIKEQ
MLSHTTIPSYAVGKKDTPTKQKMTTNSDGTFTITLTDSKNVSKYYDWQTAIKKYSYLSII
TDTEGKLVIKSTKPIPSGSAITLTAKRNCSKYQNNIVDVAPMYMISGSGSQTSATFVQDY
DPSEAKIAIYSDSLGTAQIKKVWQHNNDNSSTKADNSDIYFTVKNSSGVAVKATGSAGSY
TYSASGSVSQFKLNSSNTFLVKSLPAGTYTVSEYGKNSDGSIPYYTRTSGASKTVTVTAG
GTGTVTYAV

CDS  cDNA 1290 bp
   1 atgaaaaaca aactcagaaa aatgttgagc ttagttttag ctgtcgttat tgctatgtcg    60
  61 gcaataagtg taaatacgct tgcggctaca agaatgaata tcgcaaacgg ctcaaatcag   120
 121 aagttatatg ttgactggta cggttattca tataacttca acggcagact gaacacaagc   180
 181 acatacggac agataatcaa gctcaatgtt ggtagctcaa caggacaggt agcgtattgt   240
 241 attcagtcct caaaggatgc gtggacaggt gattataccg ctcaggatta ttacgatgat   300
 301 ttatcaagag cgcagaaact aaatctcaag cacgcactta tttatggtta tcagggtaca   360
 361 acaaactatg gctacaacgc tgatactgaa cgtatcgcaa cgcagattgt catctggaat   420
 421 atctgtgacg gttggttcaa caactttgcc gaaagcacgg ctgtcggtat attcaccgag   480
 481 ggtatgtcaa gctctatggc tacaaatgtc aaggcttgct ataacaagat caaagagcag   540
 541 atgttaagcc atacgacaat tccgtcatac gcagtaggta aaaaagatac gccaacaaag   600
 601 cagaaaatga cgactaacag cgatggaaca ttcacaataa cgctgactga tagtaaaaat   660
 661 gtgtctaagt attatgactg gcagacggca attaaaaaat acagctatct ttcgataatt   720
 721 acagacaccg aaggaaagct cgttataaag tcaacaaagc ctataccatc cggctcggct   780
 781 ataacgctta cagctaaacg taattgcagt aagtatcaga ataatattgt tgatgttgca   840
 841 ccgatgtata tgatctccgg cagtggctcg cagacttctg cgacattcgt acaagattac   900
 901 gacccgagtg aagcaaaaat tgctatttat tctgacagtt taggcacagc tcaaataaaa   960
 961 aaagtatggc agcataataa cgacaactcg agtacaaaag ctgataacag cgacatttat  1020
1021 tttactgtaa aaaacagctc gggagttgct gtcaaggcaa ccggttctgc gggtagctat  1080
1081 acttattctg caagcggatc tgtgagccag ttcaaattaa actcaagtaa cactttttta  1140
1141 gtaaaatcgt tacctgcagg aacatatacg gtatctgaat acggaaagaa ttcggacggc  1200
1201 tcgataccct attacacccg aacaagcggt gcaagcaaga cggtaaccgt tacagcaggc  1260
1261 ggtacgggta cggtcactta tgcggtttag  1290
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu