LOADING...
   ZP_02421418.1;SP17774A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02421418.1    SP17774A            JCSG 411235 Proposed Target 09-NOV-12

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02421418.1
DESCRIPTIONgi|167749291|ref|ZP_02421418.1| hypothetical protein EUBSIR_00242 [Eubacterium s
iraeum DSM 15702]
ORGANISMEubacterium siraeum DSM 15702
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR FFAS; 411235; Fold and function assignment.
DR TVPC; ZP_02421418.1; Homologs in PDB, JCSG and SG center.
DR OVP; SP17774A; Ortholog view popup.
DR TPM; ZP_02421418.1; Target PDB monitor.
DR FSS; ZP_02421418.1; Target function coverage.
PROPERTY Residues: 785 aa
Molecule Weight: 87498.79 Dalton
Isoelectric Point: 4.61
Extinction Coefficient: 121940
Gravy Index: -.46
Number of Met residues: 21
Percentage of Met residues: 2.68 %
Number of Cys residues: 2
Percentage of Cys residues: 0.25 %
SEQUENCE  amino acids 785 aa
>ZP_02421418.1  gi|167749291|ref|ZP_02421418.1| hypothetical protein EUBSIR_00242 [Eubacterium siraeum DSM 15702]
MIKIRKKILAVLLTAAMLVLMSSLVAWSDEQPATDDGTSQTEQTTDDGASADDKQDDKKD
DKKDDKEKLRTDEEGLADMSVVAENDSYKLYFDESTTNFAVQSKSDNYVWWATPLNADKD
ENAKTAQKKNMQSPLYVVYGDVSSHTSQRMSIYDASIKSDDFSFEPIENGVKVIYRLSKI
EAEIPMTITLEKDNVNVSVITEEIKEKQATDTSGLVLLEIGMLQFFNAAGMEDEGYMVVP
DGSGAVINYNNRRYNAQAYNGEVYGRDTSIGMLTRPSKTEQVYLPVIGAVTNGEKTNHGY
MAVAKSGETCASVNATVSGQNSTSYNNTWFEFKVRAEDTYYMGNRKLTVYEQGKINQPNL
TVGYYPLAKENLSYVDIAEAYRNYLIEQKGFKDKSDNIKNSYYLDLYGGTIKAQSIAGFP
VNLETAATTYEQAQEIIKQLNELGVDDIVANYNDFNGAGIKGMITADVNYAGTLGGKDAY
KTLAEYVGSINSKLFASAGITSMKDSGNGYSYTLNACKAITKAYATTNNWDIAFGIPNQV
RLVTKTTLSPYYWPDLYNKIIKSFTSEGITTINLDDATTLLYSDFSRENYSRADTMNKLV
EGYKQFKDAGFTLLASGANAYALPYVDYLTDVPVTSSNFDLFDYDIPFYEIVIHGYLPYT
TKAVNASANANDTIMLALLTATPVHYDMMYADPNDFTDSDYETLFYSNYKGWLEPSAKVY
KLYQDELKDFANLHITGYNRISGDEMETEFDGGKTIRVNTREMTLTVNGKEIDLAQYGLK
GETDE

CDS  cDNA 2358 bp
   1 atgataaaaa tcagaaaaaa gatacttgca gttctgctca cagccgcaat gctcgttttg    60
  61 atgagctcgc ttgttgcatg gtctgacgaa cagcccgcaa cggacgacgg cacatcacag   120
 121 acagagcaga caaccgatga cggcgcatcc gcagatgata agcaggacga caagaaagac   180
 181 gataaaaaag atgacaagga aaagctcaga accgatgagg aaggccttgc ggatatgagc   240
 241 gttgtggctg aaaacgacag ctacaagtta tactttgacg aatcgacgac aaactttgcg   300
 301 gttcagtcaa agagcgacaa ctatgtatgg tgggctactc ctcttaacgc agacaaggac   360
 361 gaaaatgcca agactgcgca gaagaagaat atgcagtctc cgttatatgt agtatacggt   420
 421 gacgtttcat cgcacacaag tcagagaatg agcatttacg acgcttcgat aaagtcggac   480
 481 gacttcagct ttgagccgat tgaaaacggt gtaaaggtca tatacagatt aagcaagatt   540
 541 gaagctgaaa tccctatgac gatcacactt gagaaagaca atgtaaatgt ttcggtaata   600
 601 acggaagaaa tcaaggaaaa gcaggcaacc gacacgagcg gtcttgtgct tcttgagatc   660
 661 ggtatgttac agttcttcaa tgcggcaggc atggaagatg agggctatat ggtagttccc   720
 721 gacggctcgg gcgctgtaat caactacaac aaccgccgtt acaacgcaca ggcatacaac   780
 781 ggtgaggtat acggtcgtga tacatcgatc ggtatgctga cacgtccgtc aaagacggag   840
 841 caggtttatc tccctgttat cggcgctgtt acaaacggtg aaaagacaaa tcacggttat   900
 901 atggcagttg ctaagtccgg cgaaacctgc gcaagcgtaa acgctactgt aagcggacag   960
 961 aactcaacat catacaacaa cacatggttt gagttcaagg taagagcaga ggatacctac  1020
1021 tacatgggta accgtaagct cacggtttac gagcagggca agataaacca gcccaacctc  1080
1081 acggtaggct attatcctct tgcaaaggaa aacctttctt atgttgatat tgcggaagca  1140
1141 tacagaaact accttatcga gcagaaggga ttcaaggata agagcgacaa tataaaaaac  1200
1201 agctattatc ttgaccttta cggcggtacg ataaaggcac agtcgattgc aggcttccct  1260
1261 gtaaatcttg aaacagccgc tacaacatac gagcaggctc aggaaataat aaagcagctc  1320
1321 aacgagcttg gcgttgacga tattgttgca aactacaacg atttcaacgg cgcaggcatc  1380
1381 aagggtatga tcacagccga tgtaaattac gcaggaacgc ttggcggcaa ggacgcatac  1440
1441 aagacgcttg cggaatatgt aggctcgata aacagcaagc tgttcgcaag tgcgggaatc  1500
1501 acctccatga aggacagcgg taacggctac agctacacgc tgaacgcctg caaggctata  1560
1561 acaaaggctt atgcaacaac gaataactgg gatattgcat tcggcattcc gaatcaggta  1620
1621 agacttgtta caaagacaac cttgtcacct tattactggc ctgatcttta caacaagatc  1680
1681 atcaagtcgt ttacaagcga aggaataaca acgataaacc ttgatgacgc tacaacgtta  1740
1741 ctttacagcg acttcagccg tgagaattat tccagagcag atacaatgaa caagctggta  1800
1801 gaaggctaca agcagttcaa ggacgcaggc ttcacgcttc ttgcaagcgg tgcaaacgct  1860
1861 tatgcgctcc cctatgttga ttatctgaca gacgtacctg ttacatcaag taacttcgat  1920
1921 ctgtttgact atgacattcc gttctatgag atcgttatcc acggttacct gccttacaca  1980
1981 acaaaggcgg taaacgcaag tgcaaatgca aacgatacta tcatgcttgc acttcttaca  2040
2041 gcaacacctg ttcactatga tatgatgtat gccgatccta acgatttcac agacagcgat  2100
2101 tacgagacgc tcttctattc aaactacaag ggctggctcg aaccctcggc taaggtttac  2160
2161 aagctctatc aggacgaact gaaggacttc gcaaatctcc acatcacagg atacaacaga  2220
2221 atttccggcg atgagatgga aaccgagttt gacggcggaa agacaatcag ggtaaatacc  2280
2281 agagaaatga ctctcaccgt caacggcaag gaaatcgatc ttgcacaata tggactgaag  2340
2341 ggagaaacag atgaataa  2358
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu