LOADING...
   ZP_02421200.1;SP17784A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02421200.1    SP17784A            JCSG 420669 Screening 13-MAY-16

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02421200.1
DESCRIPTIONgi|167749073|ref|ZP_02421200.1| hypothetical protein EUBSIR_00017 [Eubacterium s
iraeum DSM 15702]
ORGANISMEubacterium siraeum DSM 15702
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR FFAS; 411248; Fold and function assignment.
DR TVPC; ZP_02421200.1; Homologs in PDB, JCSG and SG center.
DR OVP; SP17784A; Ortholog view popup.
DR TPM; ZP_02421200.1; Target PDB monitor.
DR FSS; ZP_02421200.1; Target function coverage.
PROPERTY Residues: 218 aa
Molecule Weight: 22457.29 Dalton
Isoelectric Point: 3.92
Extinction Coefficient: 45950
Gravy Index: -.19
Number of Met residues: 4
Percentage of Met residues: 1.83 %
Number of Cys residues: 1
Percentage of Cys residues: 0.46 %
SEQUENCE  amino acids 218 aa
>ZP_02421200.1  gi|167749073|ref|ZP_02421200.1| hypothetical protein EUBSIR_00017 [Eubacterium siraeum DSM 15702]
MEDKFMKFSKVLASVAAATVAVSALAVSAFAADALVSMTVAESGKPSDAGQVNLWELPFD
ESVYTWAGDVDKAVATITSQAYANGALGANTVAADGWAASAQVENSAAGTNEWVWDGIGG
LKSGLDEDGKETGYFKVEVWWMNAQDDGSAATLTVDKVDFYNKNGDLLATYPVADVNPGE
SNAPVEPGETEDPAEPGKSDAVNPGECSGEPVNPPTGA

CDS  cDNA 654 bp
   1 atggaggata aattcatgaa attttctaag gttttagcaa gcgttgctgc agctacagtt    60
  61 gcggtttctg cacttgcagt aagtgctttc gcagcagacg cattagtatc tatgactgtt   120
 121 gcagaaagcg gtaagcctag tgatgccggt caggttaatt tatgggagct ccccttcgac   180
 181 gagagtgttt acacatgggc aggcgacgtt gataaggcag tagctacaat cactagccag   240
 241 gcttacgcta acggcgctct tggtgcaaac acagttgcag ctgacggttg ggcagcatct   300
 301 gcacaggttg aaaactcagc agcaggcaca aatgaatggg tttgggacgg catcggcggt   360
 361 ctcaagtcag gtcttgatga agacggtaaa gaaaccggct acttcaaggt tgaagtatgg   420
 421 tggatgaacg ctcaggacga cggttcagct gctacattaa cagttgacaa ggttgacttc   480
 481 tacaacaaga atggcgattt actcgctaca tatcctgtag ctgacgttaa ccccggcgaa   540
 541 tcaaatgctc ccgttgagcc cggtgaaaca gaagatcccg ctgagcccgg taaatctgac   600
 601 gcagttaacc ccggcgaatg ctcaggcgag cccgttaacc ctcctacagg tgcg   654
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu