LOADING...
   ZP_02027554.1;SP18073B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02027554.1    SP18073B            JCSG 421011 Protein Purification 11-JUL-15

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02027554.1
DESCRIPTIONgi|154485106|ref|ZP_02027554.1| hypothetical protein EUBVEN_02829 [Eubacterium v
entriosum ATCC 27560]
ORGANISMEubacterium ventriosum ATCC 27560
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR FFAS; 411449; Fold and function assignment.
DR TVPC; ZP_02027554.1; Homologs in PDB, JCSG and SG center.
DR OVP; SP18073B; Ortholog view popup.
DR TPM; ZP_02027554.1; Target PDB monitor.
DR FSS; ZP_02027554.1; Target function coverage.
PROPERTY Residues: 514 aa
Molecule Weight: 58430.14 Dalton
Isoelectric Point: 9.61
Extinction Coefficient: 141180
Gravy Index: -.48
Number of Met residues: 14
Percentage of Met residues: 2.72 %
Number of Cys residues: 7
Percentage of Cys residues: 1.36 %
SEQUENCE  amino acids 514 aa
>ZP_02027554.1  gi|154485106|ref|ZP_02027554.1| hypothetical protein EUBVEN_02829 [Eubacterium ventriosum ATCC 27560
MKGFKRITSIVLALAMFATGIAISGPTTVKADTATDNWKANGIVSPKQDKLIGAGYIDVK
WDNTLTDVSQYKVYVDGDLKVTVSPSSDKTMSTEFYTTQVSEHNVYVVATLKNGSNVQTA
NRRFYVTKKGVCVNTKDMGTAVDPASMNVGWYYNWDWKSFKDMNFSNKKFDDLEFVPMIW
GDSMTETSEIFDNVKSKGYKYLLAYNEPDLTWESNVRPDVMQYRWNDCVNNKGNVRLGSP
AVSVFPTWSNDWWTPFWNSMAADKKNAMSFIAVHSYQKSYDGAKSALQYLQAIDECWETY
HKPIWITEFAFWKFSINDAAGCAKVQEFMKIVIKGLNERSYVERYSWFCPNIEEDAASSS
SIFNYKTGELTTLGKIYAQIGNPLGYNAKTYGVSSYISTNTSPAACALAMPTTLYSAKAK
KKAFKYQIKAVSKAAGYQVQYGVKKNMKGSKSKYVKKLNGTIKIKFTKKQKKQIKKKKLK
RIKYYVRVRAYKTLDGKRLYCAWSSKDKVKVKTR

CDS  cDNA 1545 bp
   1 atgaaaggat ttaaaagaat cacttcaatt gttttggcat tggcaatgtt tgcaacaggt    60
  61 attgcaataa gcggacctac tacagtaaaa gctgatacag caacagacaa ttggaaggct   120
 121 aatggcattg taagtcctaa acaggacaag ttaattggcg caggatacat tgatgttaaa   180
 181 tgggataaca cattaacaga cgtatcacag tataaagttt atgttgatgg tgatttaaaa   240
 241 gtaacagtat caccttcatc agacaagact atgagtacag agttctatac aacacaggta   300
 301 agtgaacata atgtatatgt agttgcaaca ttaaagaacg gttcaaacgt tcagacagct   360
 361 aacagacgtt tttatgtaac aaagaaaggt gtttgtgtaa acactaaaga tatgggtaca   420
 421 gcagtagatc cagcctcaat gaatgttggt tggtattaca actgggattg gaagtcattt   480
 481 aaagatatga acttctcaaa caagaagttt gatgatttgg aatttgtacc aatgatttgg   540
 541 ggcgacagca tgacagaaac aagcgagatt tttgataatg ttaagagcaa aggttataag   600
 601 tatttattag cttataatga acctgattta acatgggaat caaatgtaag acctgatgtt   660
 661 atgcagtata gatggaatga ctgtgtaaat aacaaaggta atgtaagact tggttcacca   720
 721 gcagtttcag ttttccctac atggtcaaac gattggtgga caccattctg gaactcaatg   780
 781 gcagcagaca agaagaatgc tatgtcattt atagcagttc attcatacca gaaaagctat   840
 841 gatggagcta agtcagcact tcagtacctt caggcaattg atgaatgctg ggaaacttat   900
 901 cataagccaa tctggattac agaatttgct ttctggaaat tcagcattaa cgatgcagca   960
 961 ggatgtgcaa aagtacagga atttatgaag atcgttatta aaggtcttaa tgaaagaagc  1020
1021 tatgttgaaa gatattcatg gttctgtcca aatatagaag aagatgcagc aagctcatca  1080
1081 agtatcttta attacaagac tggtgaatta acaacattag gaaagattta tgcacagatt  1140
1141 ggaaatcctt taggatataa tgcaaaaacg tatggtgtaa gttcttacat ttcaactaat  1200
1201 acatcaccag cagcttgtgc attagccatg ccaacaacat tatatagtgc aaaagctaaa  1260
1261 aagaaagctt tcaagtatca gattaaagct gtttcaaaag cagcaggata ccaggtacag  1320
1321 tatggtgtta agaagaacat gaaaggctca aagagcaaat atgttaagaa attaaacgga  1380
1381 acaattaaga ttaagttcac aaagaaacag aaaaaacaga ttaagaagaa aaagcttaag  1440
1441 agaattaaat attatgtacg tgtaagagca tataagactc ttgatggaaa gagattatat  1500
1501 tgcgcatgga gcagcaaaga taaagttaaa gttaagacta gatag  1545
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu