LOADING...
   ZP_02031627.1;SP18739A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02031627.1    SP18739A            JCSG 418211 Crystal Hit 12-DEC-06

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02031627.1
DESCRIPTIONgi|154492001|ref|ZP_02031627.1| hypothetical protein PARMER_01632 [Parabacteroid
es merdae ATCC 43184]
ORGANISMParabacteroides merdae
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR FFAS; 413035; Fold and function assignment.
DR TVPC; ZP_02031627.1; Homologs in PDB, JCSG and SG center.
DR OVP; SP18739A; Ortholog view popup.
DR TPM; ZP_02031627.1; Target PDB monitor.
DR FSS; ZP_02031627.1; Target function coverage.
PROPERTY Residues: 167 aa
Molecule Weight: 19420.33 Dalton
Isoelectric Point: 4.77
Extinction Coefficient: 15930
Gravy Index: -.24
Number of Met residues: 8
Percentage of Met residues: 4.79 %
Number of Cys residues: 4
Percentage of Cys residues: 2.40 %
SEQUENCE  amino acids 167 aa
>ZP_02031627.1  gi|154492001|ref|ZP_02031627.1| hypothetical protein PARMER_01632 [Parabacteroides merdae ATCC 43184
MTKIQLLATLLALFIFAMLGACNNEDYPEPDVFKVTPDLRTRINTGIKMASRTEKRLFNE
TFNSFLHKCDEMGSENTPYQYMETEEYADLKKLILSSSPATCYLLMDRYLKRNPPFFSFI
LNDLIETAYPNTADKIANRMKSLTTVQETMELFPQVCLEIWLDEIEE

CDS  cDNA 504 bp
   1 atgacaaaaa tacaactatt agctacactg ttggcacttt tcatctttgc catgctggga    60
  61 gcatgcaata atgaagatta tccggaaccg gatgttttca aggtaacacc agacctccgc   120
 121 acccgtatca atactgggat aaaaatggct tcccgcacag aaaagaggct tttcaacgag   180
 181 acattcaact cttttcttca caaatgcgat gaaatgggat cagaaaatac tccctatcaa   240
 241 tatatggaaa cggaagagta tgcagatctg aaaaagctaa tactgtcatc ctctcccgct   300
 301 acctgctatt tgttaatgga ccgctaccta aaacgaaatc cccctttctt ctctttcatt   360
 361 ctgaacgatc tgatcgaaac tgcctacccc aatacagcgg ataagattgc taaccggatg   420
 421 aagtcgttga ctaccgtaca ggaaacaatg gagctattcc ctcaggtttg cttggaaatc   480
 481 tggctggatg aaatagaaga atag   504
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu