LOADING...
   NP_250641.1;SP19108A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_250641.1    SP19108A            JCSG 413313 Proposed Target 09-NOV-12

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_250641.1
DESCRIPTIONgi|15597147|ref|NP_250641.1| hypothetical protein [Pseudomonas aeruginosa PA01]
ORGANISMPSEUDOMONAS AERUGINOSA
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR FFAS; 413313; Fold and function assignment.
DR TVPC; NP_250641.1; Homologs in PDB, JCSG and SG center.
DR OVP; SP19108A; Ortholog view popup.
DR TPM; NP_250641.1; Target PDB monitor.
DR FSS; NP_250641.1; Target function coverage.
PROPERTY Residues: 421 aa
Molecule Weight: 45708.8 Dalton
Isoelectric Point: 4.82
Extinction Coefficient: 56840
Gravy Index: -.23
Number of Met residues: 5
Percentage of Met residues: 1.19 %
Number of Cys residues: 1
Percentage of Cys residues: 0.24 %
SEQUENCE  amino acids 421 aa
>NP_250641.1  gi|15597147|ref|NP_250641.1| hypothetical protein [Pseudomonas aeruginosa PA01]
MTQTLSLRAVLCATTLVSPFLAQAATESEVEALKKELLELRQRYEAQQNALMVLEQRVRQ
VEAQPQAPQPQRLVKSIQPPAQARNDANAVAGTYGASLKDDGAPAPSVENIYQDASGFFG
GGTFSLETGLTYSHYDTRQLFLNGFLALDSIFLGNIGVDQIDADIWTLDLTGRYNWNQRW
QVDINAPVVYRESTYQSAGAGGSTSQITEKSVTGDPRLGDVSFGVAYKFLDESESTPDAV
VSLRVKAPTGKDPYGIKLKQVPGNNNLNVPDDLPTGNGVWSITPGISLVKTVDPAVLFGS
LSYTYNFEESFDDINPQQGVKTGGKVKLGNWFQLGVGVAFALNEKMSMSFSFSELISQKS
KVKQDGQSWQTVSGSDANAGYFGLGMTYAVSNRFSIVPSLSIGITPDAPDFTFGVKFPYY
F

CDS  cDNA 1266 bp
   1 atgacccaga cactctcgct gcgagctgtc ctctgcgcca ccaccctggt ttccccgttc    60
  61 ctggcgcagg ccgcgacgga atccgaggtc gaggcgctga agaaggaact cctggagctg   120
 121 cgccaacgct acgaggccca gcagaacgcc ctgatggtcc tcgaacagcg cgtgcgccag   180
 181 gtcgaggcgc aaccccaggc gccgcagccg caacgcctgg tcaagtcgat ccagccgccg   240
 241 gcgcaggcgc gcaacgacgc caacgcggtc gccggcacct acggcgccag cctcaaggac   300
 301 gatggcgcgc ccgcgcccag cgtggaaaac atctaccagg acgccagcgg cttcttcggc   360
 361 ggcggcacct tcagcctgga gaccggcctc acctacagcc actacgacac ccgccagttg   420
 421 ttcctcaacg gcttcctggc gctggactcg atcttcctcg gcaacatcgg cgtggaccag   480
 481 atcgatgccg acatctggac cctcgacctg accggccgct acaactggaa ccagcgctgg   540
 541 caggtggata tcaacgcccc ggtggtctat cgcgaatcga cctaccagtc cgccggcgcc   600
 601 ggcggctcga cctcgcagat caccgagaaa tcggtgaccg gcgacccacg cctgggcgac   660
 661 gtcagcttcg gcgtcgccta caagttcctc gacgaaagcg agagcacccc ggacgcggtg   720
 721 gtcagcctgc gggtcaaggc gcccaccggc aaggatccct acggcatcaa gctgaagcag   780
 781 gtaccgggca acaacaacct caacgtgccc gacgacctgc ccaccggcaa cggcgtctgg   840
 841 tcgatcaccc cgggcatctc gctggtgaag acggtggacc cggcggtgct gttcggcagc   900
 901 ctgtcgtata cctacaactt cgaagagtcg ttcgacgaca tcaacccgca gcaaggcgtg   960
 961 aagaccggcg gcaaggtcaa gctcggcaac tggttccaac tcggcgtcgg cgtggccttc  1020
1021 gcgctgaacg agaagatgag catgtcgttc tccttctccg aactgatcag ccagaagagc  1080
1081 aaggtcaagc aggacggcca gagctggcag accgtcagcg gcagcgacgc caacgccggc  1140
1141 tacttcggcc tgggcatgac ctatgcggtg agcaacaggt tcagcatcgt gcccagcctg  1200
1201 tccatcggca tcactccgga cgcgccggac ttcaccttcg gcgtgaaatt cccctactac  1260
1261 ttctga  1266
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2136520 2137785 -1 Glimmer3 score 22.35 good
Genemark probabilities .94   .68 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu