LOADING...
   YP_002937421.1;SP19385A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_002937421.1    SP19385A            JCSG 419656 Protein Purification 10-SEP-29

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_002937421.1
DESCRIPTIONgi|238923905|ref|YP_002937421.1| hypothetical protein EUBREC_1533 [Eubacterium r
ectale ATCC 33656]
ORGANISMEubacterium rectale ATCC 33656
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR FFAS; 411151; Fold and function assignment.
DR TVPC; YP_002937421.1; Homologs in PDB, JCSG and SG center.
DR OVP; SP19385A; Ortholog view popup.
DR TPM; YP_002937421.1; Target PDB monitor.
DR FSS; YP_002937421.1; Target function coverage.
PROPERTY Residues: 106 aa
Molecule Weight: 12313.43 Dalton
Isoelectric Point: 8.5
Extinction Coefficient: 20400
Gravy Index: -.22
Number of Met residues: 1
Percentage of Met residues: 0.94 %
Number of Cys residues: 2
Percentage of Cys residues: 1.89 %
SEQUENCE  amino acids 106 aa
>YP_002937421.1  gi|238923905|ref|YP_002937421.1| hypothetical protein EUBREC_1533 [Eubacterium rectale ATCC 33656]
MLFFVQKKKSTIWKFIPIVLLAACTVLFGAFSSKLSDDNTKRSKSTLERALTRSITQCYA
LEGTYPPDINYLTDHYGLTYDSDYYYIDYQYIGSNLRPDVTIIERK

CDS  cDNA 321 bp
   1 atgctgtttt ttgttcagaa aaagaaatca accatatgga aattcatacc aattgtgctt    60
  61 ttagccgcat gtactgtttt gtttggtgct ttctcttcaa agctgtcaga tgacaatacc   120
 121 aaaagaagca agagcacgct ggaacgcgcc ctcacacgaa gtatcacaca gtgctatgct   180
 181 cttgagggaa cataccctcc ggacataaat tatctaacag accactatgg tctcacctac   240
 241 gacagcgact attattacat agactatcaa tacatcggct ccaatctgcg tcccgatgtg   300
 301 acaataatag agaggaaata a   321
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu