LOADING...
   YP_001297902.1;SP7807AE
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001297902.1    SP7807AE            JCSG 409826 Proposed Target 09-NOV-12

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001297902.1
DESCRIPTIONgi|150003158|ref|YP_001297902.1| hypothetical protein BVU_0572 [Bacteroides vulg
atus ATCC 8482]
ORGANISMBacteroides vulgatus ATCC 8482
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR FFAS; 409826; Fold and function assignment.
DR TVPC; YP_001297902.1; Homologs in PDB, JCSG and SG center.
DR OVP; SP7807AE; Ortholog view popup.
DR TPM; YP_001297902.1; Target PDB monitor.
DR FSS; YP_001297902.1; Target function coverage.
PROPERTY Residues: 656 aa
Molecule Weight: 74003.82 Dalton
Isoelectric Point: 4.82
Extinction Coefficient: 145080
Gravy Index: -.5
Number of Met residues: 14
Percentage of Met residues: 2.13 %
Number of Cys residues: 8
Percentage of Cys residues: 1.22 %
SEQUENCE  amino acids 656 aa
>YP_001297902.1  gi|150003158|ref|YP_001297902.1| hypothetical protein BVU_0572 [Bacteroides vulgatus ATCC 8482]
MKTMNKLFLGLGFCAGLVSCSDFDEVNTNPTAAGEEYVKPQYALNNSIGQAQMNPGTAER
IVVYNWASAARICGEMSFLNVGRYSDDYTSSYYYPDLSASIKNATLAITAVENQLEAATT
TAHEKEFFPNVKQFARIWRAYLISEFVDNFGPYPIESFLGENPVFNSEKDDYEFILKELK
EAAAAINTSVLPVEAEGKCDPFDNVKYDPVKWQKYANSLRMRLAMRLSNIDKATAQAEFE
DAAKGNKILTADDMFAVKENDGWDVFSGVYTRSFDDQVLSSTVANLLTNLGGVKVTEQRS
DLASYVKPANYLGIKYDRHYVANTDNPTKQYWLDGMPENLDPRALKIFCLPDDENAENYI
DKYNDRTAKDFVLYTVDENGNPIPNKDNPGEIKIDATRCWNGYPAGSRGGWSPTLAYNQL
VTNGYGPGCTLPMLGKDYCKGKSRIFFAAWETYFLLAEASLYGWNTGTTAKEAYENGIKA
SFEYFGVSEYVNDYLNSTNYNRVGTSVKFDHTTEPTAEQMTYVDGYSKEQKTVTYEYPTA
SKTLYGKALNDHLTKIITQKFIAQTPYLVLEMWSDFRRLGLPFFEIPANESSMTGSDMVN
VWNPNSWKDGQKWEFYPQRMRYPSSLENADPEGYKQAVELLGGSDNIITPLWWTGR

CDS  cDNA 1971 bp
   1 atgaaaacaa tgaataaatt atttttgggg cttggctttt gcgccggatt agtttcctgc    60
  61 tctgactttg atgaagtcaa taccaatccc acagccgccg gtgaggaata tgtaaaacct   120
 121 caatatgcat tgaataattc tataggacag gcacagatga atcccggtac cgcagagcgt   180
 181 atagtagtct ataactgggc tagtgctgcc agaatttgtg gagaaatgag ttttctgaac   240
 241 gtaggccgct atagtgatga ttacacatct tcttattatt atcctgatct cagtgccagt   300
 301 attaaaaatg ctacgttggc tattacagca gtagagaacc agctcgaagc ggccactacc   360
 361 actgcacatg aaaaagaatt tttcccgaac gtaaagcaat ttgcccgtat ctggcgtgcc   420
 421 tatcttatca gtgagtttgt cgataatttc ggaccttatc ctattgaaag tttcctaggg   480
 481 gaaaatcctg ttttcaactc agagaaagat gattatgaat tcattttaaa ggagttgaaa   540
 541 gaagccgcag cagctatcaa cacctctgtc ctgcctgttg aggcagaagg caaatgcgac   600
 601 ccgtttgaca atgtaaaata tgatcctgtg aagtggcaga aatatgcaaa ttcactccgt   660
 661 atgcgtctgg ccatgcgttt atcaaacatc gacaaggcaa ctgcacaggc cgaatttgag   720
 721 gatgcggcca aaggtaacaa gattttaacg gctgatgata tgtttgcagt aaaagaaaat   780
 781 gatggatggg atgtcttttc cggagtatat acccgttcat ttgacgatca ggttctttct   840
 841 tcaacagttg ccaatcttct gactaattta ggtggtgtta aagtaacaga acaacgttcc   900
 901 gatttggcta gttatgttaa accagctaat tatttaggta ttaaatatga cagacattat   960
 961 gttgctaata cagataatcc tactaaacaa tattggctgg atggtatgcc ggaaaatctt  1020
1021 gacccgcgtg cattaaagat attctgtctg cctgatgatg aaaatgctga gaactacata  1080
1081 gataaatata atgacaggac agctaaagat ttcgttcttt acacagtaga cgaaaacgga  1140
1141 aatccgattc ctaacaagga taatcccgga gaaataaaga ttgatgcaac tcgttgttgg  1200
1201 aatggttatc ccgctggttc gcgtggtgga tggtcgccaa ccttggctta taaccaactg  1260
1261 gtgacaaatg gatatggccc cggctgtact cttccaatgt tgggtaaaga ctattgtaag  1320
1321 ggaaaatctc gcatattctt tgcagcatgg gaaacgtatt tcttgctagc agaagcttca  1380
1381 ttgtatggtt ggaacactgg aacaacagcg aaagaagcct atgaaaacgg tattaaagct  1440
1441 agttttgaat actttggtgt tagcgaatat gtgaatgatt atctgaattc caccaactac  1500
1501 aatcgtgtag gtacttcggt caaatttgat cataccactg aacctactgc tgaacaaatg  1560
1561 acttatgtgg atggatacag caaggaacag aagactgtta cttatgaata tcctacagct  1620
1621 tctaaaacgt tatatggaaa agcattgaat gaccacctga ctaaaattat cactcaaaaa  1680
1681 ttcattgcac aaactccgta tttggtattg gaaatgtggt cggatttccg ccgtttggga  1740
1741 ttaccattct ttgagattcc tgcaaacgaa agttcaatga ccggttcaga catggttaat  1800
1801 gtctggaatc ctaattcttg gaaagacgga cagaaatggg aattttatcc acagcgtatg  1860
1861 cgatatcctt ccagtctgga gaatgcagac cccgaaggct ataaacaagc tgtagagtta  1920
1921 ttaggaggct cagataatat catcaccccc ttatggtgga ccggacgtta a  1971
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu