LOADING...
   TM0001;TM0001
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0001    TM0001            JCSG 281882 Protein Purification 04-JUL-20

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0001
DESCRIPTIONPossible calcitonin homolog
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WXL6_THEMA
DR SPTR; Q9WXL6 (flat text); Q9WXL6 (good view)
DR GenBank; AAD35095
DR FFAS; 281882; Fold and function assignment.
DR TVPC; TM0001; Homologs in PDB, JCSG and SG center.
DR OVP; TM0001; Ortholog view popup.
DR TPM; TM0001; Target PDB monitor.
DR FSS; TM0001; Target function coverage.
PROPERTY Residues: 41 aa
Molecule Weight: 4633.2 Dalton
Isoelectric Point: 6.04
Extinction Coefficient: 4470
Gravy Index: .16
Number of Met residues: 2
Percentage of Met residues: 4.88 %
Number of Cys residues: 2
Percentage of Cys residues: 4.88 %
SEQUENCE  amino acids 41 aa
>TM0001  TM0001 hypothetical protein
MVYGKEGYGRSKNILLSECVCGIISLELNGFQYFLRGMETL

CDS  cDNA 123 bp
   1 atggtttatg gaaaggaagg atatggaagg tcaaaaaaca tcttgctttc agagtgtgtt    60
  61 tgtggtataa tttctcttga actcaacggg tttcaatact tccttagagg tatggaaact   120
 121 ctg   123
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
Glimmer3 score - -
Genemark probabilities -   - -
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu