|
TM0003;TM0003 |
Protein Sequence Comparative Analysis (PSCA) | |
|
TM0003 TM0003 JCSG 281884 Protein Purification 02-AUG-21 Protein Sequence Information
SEQUENCE amino acids 40 aa >TM0003 TM0003 hypothetical protein METVKAYEVEDIPAIGFNNSLEVWKLFPASSSRSTSSSFQ CDS cDNA 120 bp 1 atggaaactg tgaaggcgta tgaggtggag gatattcctg caattggttt caataattcc 60 61 ttagaggtat ggaaactttt tccagcatct tcttcacgaa gtacgtcttc atcgtttcaa 120Target constructs Download sequence in PIR or FASTA format Chemical properties of sequence with tag
Notes The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951). Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function. |