LOADING...
   TM0005;TM0005
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0005    TM0005            JCSG 281886 Protein Purification 04-FEB-02

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0005
DESCRIPTIONDNA helicase, putative.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WXM0_THEMA
DR SPTR; Q9WXM0 (flat text); Q9WXM0 (good view)
DR GenBank; AAD35099
DR Interpro; IPR004483; put_DNA_helic;
DR PDB; 4B3F; Highly similar; 26-SEP-12; DNA-BINDING PROTEIN SMUBP-2;
DR PDB; 4B3G; Highly similar; 26-SEP-12; DNA-BINDING PROTEIN SMUBP-2;
DR PDB; 2XZL; Highly similar; 30-MAR-11; ATP-DEPENDENT HELICASE NAM7;
DR PDB; 2GJK; Highly similar; 09-JAN-07; REGULATOR OF NONSENSE TRANSCRIPTS 1;
DR PDB; 2GK6; Highly similar; 09-JAN-07; REGULATOR OF NONSENSE TRANSCRIPTS 1;
DR PDB; 2GK7; Highly similar; 09-JAN-07; REGULATOR OF NONSENSE TRANSCRIPTS 1;
DR PDB; 2XZO; Highly similar; 30-MAR-11; REGULATOR OF NONSENSE TRANSCRIPTS 1;
DR PDB; 2XZP; Highly similar; 30-MAR-11; REGULATOR OF NONSENSE TRANSCRIPTS 1;
DR FFAS; 281886; Fold and function assignment.
DR TVPC; TM0005; Homologs in PDB, JCSG and SG center.
DR OVP; TM0005; Ortholog view popup.
DR TPM; TM0005; Target PDB monitor.
DR FSS; TM0005; Target function coverage.
PROPERTY Residues: 650 aa
Molecule Weight: 74237.73 Dalton
Isoelectric Point: 9.09
Extinction Coefficient: 54890
Gravy Index: -.36
Number of Met residues: 9
Percentage of Met residues: 1.38 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 650 aa
>TM0005  TM0005 DNA helicase, putative
MTVQQFIKKLVRLVELERNAEINAMLDEMKRLSGEEREKKGRAVLGLTGKFIGEELGYFL
VRFGRRKKIDTEIGVGDLVLISKGNPLKSDYTGTVVEKGERFITVAVDRLPSWKLKNVRI
DLFASDITFRRQIENLMTLSSEGKKALEFLLGKRKPEESFEEEFTPFDEGLNESQREAVS
LALGSSDFFLIHGPFGTGKTRTLVEYIRQEVARGKKILVTAESNLAVDNLVERLWGKVSL
VRIGHPSRVSSHLKESTLAHQIETSSEYEKVKKMKEELAKLIKKRDSFTKPSPQWRRGLS
DKKILEYAEKNWSARGVSKEKIKEMAEWIKLNSQIQDIRDLIERKEEIIASRIVREAQVV
LSTNSSAALEILSGIVFDVVVVDEASQATIPSILIPISKGKKFVLAGDHKQLPPTILSED
AKDLSRTLFEELITRYPEKSSLLDTQYRMNELLMEFPSEEFYDGKLKAAEKVRNITLFDL
GVEIPNFGKFWDVVLSPKNVLVFIDTKNRSDRFERQRKDSPSRENPLEAQIVKEVVEKLL
SMGVKEDWIGIITPYDDQVNLIRELIEAKVEVHSVDGFQGREKEVIIISFVRSNKNGEIG
FLEDLRRLNVSLTRAKRKLIATGDSSTLSVHPTYRRFVEFVKKKGTYVIF

CDS  cDNA 1950 bp
   1 atgacggttc agcagttcat aaagaagctt gtgaggctcg tagagctcga aaggaacgcg    60
  61 gaaataaacg caatgctcga tgagatgaag cggctctcgg gggaggaaag agagaaaaag   120
 121 ggtcgtgccg ttctgggtct cacaggaaaa tttataggag aagaacttgg atatttcctt   180
 181 gtgaggtttg gaagaagaaa gaagatagac acagaaatcg gtgtgggtga tcttgttctc   240
 241 ataagcaaag gaaaccccct caagagtgat tacacgggaa cggttgtgga gaaaggagag   300
 301 cgtttcatca cggtagcggt cgataggctt ccatcgtgga agctcaaaaa tgtgaggata   360
 361 gacctctttg cgagcgacat cacgttcaga agacagatag agaacctgat gacgctttct   420
 421 tcggaaggga aaaaagctct tgagtttcta cttggaaaga ggaagccaga agagtcgttt   480
 481 gaagaagagt tcactccctt cgatgaagga ttgaacgaga gtcagaggga agcggtttcc   540
 541 cttgccctcg gaagttctga tttctttctc atacacggcc ccttcggcac gggaaagacc   600
 601 agaacactcg tggagtacat aagacaggaa gtagcacgtg gaaagaaaat tctggtcaca   660
 661 gcggagagta accttgctgt ggacaacctc gtggagaggc tctgggggaa agtgtctctg   720
 721 gtgagaattg gccatccttc gcgcgtgtcc tctcacctga aggagtccac actcgcacat   780
 781 caaatcgaaa caagcagtga gtacgagaag gtaaagaaga tgaaggaaga actcgcaaag   840
 841 ttgatcaaaa aaagggacag tttcacaaaa ccttcaccgc agtggagaag agggctcagc   900
 901 gacaagaaga tcctggagta cgcagagaag aactggagtg ccaggggagt ttccaaggaa   960
 961 aagataaagg agatggcaga gtggataaag ttaaacagcc agattcaaga tatcagggac  1020
1021 ctcatagaac gcaaagagga aataatagcg agcaggatag tacgggaagc gcaggttgtg  1080
1081 ctttcaacca attcgtccgc agctctggaa atactatcgg gaatagtctt cgatgtggta  1140
1141 gttgttgacg aggcctctca ggcaactatc ccaagcatcc tcattcccat atcgaaaggc  1200
1201 aaaaagttcg tcctcgctgg ggatcacaaa cagcttccac ccacgatact ctcagaagac  1260
1261 gcgaaggatc tttcgagaac actgtttgaa gaactcataa ctcgatatcc cgagaagtct  1320
1321 tctcttctcg atacccagta cagaatgaac gaacttttga tggagtttcc gagtgaagaa  1380
1381 ttttacgacg gaaaactgaa agcggccgag aaagtcagaa acataacgct cttcgacctt  1440
1441 ggagtggaga taccgaactt tggaaagttc tgggatgttg ttctctcccc aaaaaacgtt  1500
1501 ctggtcttca tagacacaaa gaacagatct gacagatttg aaaggcaaag gaaagactct  1560
1561 ccctcgagag agaatccatt agaagcacag atcgtgaaag aggttgtgga aaagcttctc  1620
1621 tccatggggg tgaaggagga ttggatcggg atcatcactc cctacgatga tcaggtgaat  1680
1681 ctcataagag agttgatcga agcgaaagta gaagtacaca gtgtggatgg ttttcaggga  1740
1741 agggaaaaag aggtcatcat catctcattt gtgcgttcga acaaaaacgg tgaaataggg  1800
1801 ttcctcgaag atctgagaag actcaacgtc tcactcacac gggcgaaaag aaaactgata  1860
1861 gcaacgggag attcgagcac gctctctgtc catccaactt acagaagatt tgtagagttt  1920
1921 gtgaaaaaga agggaactta cgtgatcttt  1950
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
3155 5107 -2 Glimmer3 score 14.61 good
Genemark probabilities .98   .98 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu