LOADING...
   TM0006;TM0006
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0006    TM0006            JCSG 281887 Integration 04-JUL-13

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0006
DESCRIPTIONMandelate racemase/muconate lactonizing enzyme family protein
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WXM1_THEMA
DR SPTR; Q9WXM1 (flat text); Q9WXM1 (good view)
DR GenBank; AAD35100
DR Pfam; PF01188; MR_MLE;
DR Interpro; IPR001354; MR_MLE;
DR PDB; 2ZAD; Identical; 08-APR-08; MUCONATE CYCLOISOMERASE;
DR PDB; 3DEQ; Identical; 25-NOV-08; MUCONATE CYCLOISOMERASE;
DR PDB; 3DER; Identical; 25-NOV-08; MUCONATE CYCLOISOMERASE;
DR PDB; 3DES; Identical; 25-NOV-08; MUCONATE CYCLOISOMERASE;
DR PDB; 3DFY; Identical; 25-NOV-08; MUCONATE CYCLOISOMERASE;
DR PDB; 3U9I; Highly similar; 09-NOV-11; MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME, C DOMAIN PRO;
DR PDB; 1JPM; Highly similar; 21-DEC-01; L-ALA-D/L-GLU EPIMERASE;
DR PDB; 1TKK; Highly similar; 31-AUG-04; SIMILAR TO CHLOROMUCONATE CYCLOISOMERASE;
DR FFAS; 281887; Fold and function assignment.
DR TVPC; TM0006; Homologs in PDB, JCSG and SG center.
DR OVP; TM0006; Ortholog view popup.
DR TPM; TM0006; Target PDB monitor.
DR FSS; TM0006; Target function coverage.
PROPERTY Residues: 345 aa
Molecule Weight: 38662.3 Dalton
Isoelectric Point: 5.45
Extinction Coefficient: 14900
Gravy Index: -.19
Number of Met residues: 9
Percentage of Met residues: 2.61 %
Number of Cys residues: 2
Percentage of Cys residues: 0.58 %
SEQUENCE  amino acids 345 aa
>TM0006  TM0006 muconate cycloisomerase
MSRIVNVKLSLKRYEYEKPFHITGSVSSESRNVEVEIVLESGVKGYGEASPSFRVNGERV
EALLAIENAVREMITGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVCY
LLGGKRDEIETDKTVGIDTVENRVKEAKKIFEEGFRVIKIKVGENLKEDIEAVEEIAKVT
RGAKYIVDANMGYTQKEAVEFARAVYQKGIDIAVYEQPVRREDIEGLKFVRFHSPFPVAA
DESARTKFDVMRLVKEEAVDYVNIKLMKSGISDALAIVEIAESSGLKLMIGCMGESSLGI
NQSVHFALGTGAFEFHDLDSHLMLKEEVFRGKFIQDGPRMRVKDQ

CDS  cDNA 1035 bp
   1 atgtcgagga tcgtgaacgt gaagctttct ctcaagagat acgaatacga aaagccgttt    60
  61 cacataactg gaagcgtatc ttccgaaagc agaaatgtcg aggttgaaat cgttttggaa   120
 121 agtggtgtca aagggtacgg agaagcgtct ccctccttca gagtgaacgg tgaaagggtg   180
 181 gaagcacttc ttgcaataga aaacgctgtg agggagatga tcacaggcat cgatgtgcga   240
 241 aactatgcca ggatcttcga gatcacagac aggctcttcg ggtttccgag tttgaaagca   300
 301 gccgttcaat ttgccacact ggacgctctc tctcaagaac ttggaacaca ggtctgttat   360
 361 ctccttggag gaaaaagaga tgagatagaa acggacaaaa cagttgggat agacaccgtc   420
 421 gaaaaccgtg tgaaggaggc aaagaagata ttcgaagagg gtttcagagt gatcaagata   480
 481 aaagttggag agaatttgaa ggaagacatc gaagccgtgg aagagatagc gaaagtcacc   540
 541 cgtggagcga agtacatagt tgacgcgaac atgggataca cccagaagga ggcggtggag   600
 601 ttcgcgagag cagtatatca aaaaggaata gacatcgctg tgtacgaaca acctgtgagg   660
 661 agggaagaca tagaaggctt gaagttcgtg aggttccact ctccgtttcc cgtcgcggcg   720
 721 gacgaatccg cgaggacgaa gttcgatgtg atgaggcttg tgaaggaaga agcggttgat   780
 781 tacgtgaaca taaaactcat gaagtcggga atttccgacg ctcttgccat agtggaaata   840
 841 gcagaatcgt caggtttgaa gctcatgatc ggatgcatgg gagagtcctc gctcggaata   900
 901 aatcagagtg ttcattttgc gcttggaacg ggagcttttg agtttcatga cctcgacagt   960
 961 cacctgatgc tgaaggaaga agttttcaga ggaaaattca tccaggatgg tccgagaatg  1020
1021 agggtgaaag atcaa  1035
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
5104 6141 -1 Glimmer3 score 16.14 good
Genemark probabilities .94   1 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu