LOADING...
   TM0007;TM0007
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0007    TM0007            JCSG 281888 Protein Purification 04-JUL-19

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0007
DESCRIPTIONTransglutaminase-like enzyme, putative cysteine protease
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WXM2_THEMA
DR SPTR; Q9WXM2 (flat text); Q9WXM2 (good view)
DR GenBank; AAD35101
DR Pfam; PF01841; Transglut_core;
DR Interpro; IPR002931; Trnsglumase_like;
DR FFAS; 281888; Fold and function assignment.
DR TVPC; TM0007; Homologs in PDB, JCSG and SG center.
DR OVP; TM0007; Ortholog view popup.
DR TPM; TM0007; Target PDB monitor.
DR FSS; TM0007; Target function coverage.
PROPERTY Residues: 438 aa
Molecule Weight: 52344.04 Dalton
Isoelectric Point: 5.53
Extinction Coefficient: 75290
Gravy Index: -.53
Number of Met residues: 9
Percentage of Met residues: 2.05 %
Number of Cys residues: 2
Percentage of Cys residues: 0.46 %
SEQUENCE  amino acids 438 aa
>TM0007  TM0007 hypothetical protein
MEFLIYSLPEEVLREEMLGNFSVALKLIDDFLKKDLPLLQRERLIYEKERIERLLEDYPF
TEKEAMEKMREMFEGFSEGEFQYLMNEGVLDYIVVEGEKRFERRFFHNLAFVRSEYRERL
RKDERSEKARRILHERLERLIKGEDPKRYRIRARITLKLKETSSKHRVWLPFPKESLQIE
SVKLLRTSHKSYYISPNDVPQRTIYFEGEDSTFFVEFEYIVREWVNHVDPERVSEKVAGF
EEFLKEEPPHIVFTPKLRWLTQTVVGSEVNPYLKAKRIYDWITLNVRYSYVKPYALYENI
TDFVVNNLKGDCGFQALLFITMCRIAGVPARWQSGWYINPIFGSPHDWALFYVEPYGWLP
ADLSFGGARRDNESFRSFYFGNLDGFRMVANDGFMKDFDPKTRFVRSDPTDNQVGEAESE
EKRLPFESTIEVISFEEV

CDS  cDNA 1314 bp
   1 atggagtttc tcatctacag tttaccagag gaagttctca gagaagaaat gctggggaac    60
  61 ttttcagtcg ctttgaagct gatcgatgac tttctgaaaa aggacctccc tttgcttcag   120
 121 cgtgaaagac tcatctacga aaaagagagg atcgaaagac tcctcgagga ttatcctttc   180
 181 accgaaaaag aagcgatgga aaagatgagg gagatgttcg agggtttctc agagggagag   240
 241 ttccaatatc tcatgaacga aggagtactc gactacatcg tcgtggaggg tgagaaacga   300
 301 ttcgaaaggc gtttcttcca caacctcgcc ttcgtcagat cggagtacag agaaagactc   360
 361 agaaaagatg aaagaagtga aaaagcccga agaattctcc acgaacggct ggagcgtctc   420
 421 ataaagggtg aggatccgaa aagatacaga ataagagcga gaataacttt gaaactgaag   480
 481 gaaacatcct ccaagcaccg cgtatggctt ccgtttccca aggaaagcct tcagatcgaa   540
 541 agtgtgaaac ttctgagaac aagtcacaaa agttactaca tttctccgaa cgatgttcca   600
 601 cagaggacca tctacttcga aggcgaagac agcacttttt tcgtggaatt cgagtacatt   660
 661 gttagagagt gggtgaacca cgtcgatcct gaaagagttt cagagaaagt tgcgggattt   720
 721 gaagagttcc tgaaagaaga gcctccacac atcgttttta ctccgaaact caggtggtta   780
 781 acacaaacgg tggtgggtag cgaggtaaac ccgtacctca aagcgaaaag gatatacgac   840
 841 tggatcacac tcaacgtgag gtactcctac gtgaaaccgt atgccctgta cgagaatata   900
 901 acggattttg tggtgaacaa cctgaaaggc gactgtggtt ttcaggcact tctcttcata   960
 961 acgatgtgca ggatcgcagg tgtccccgca agatggcagt ctggatggta cataaatccg  1020
1021 atcttcggtt ctcctcacga ctgggcactt ttctacgtgg agccctatgg gtggcttcct  1080
1081 gcggatcttt cctttggcgg tgcgaggaga gataatgaat ctttcagaag cttctacttt  1140
1141 ggaaacctgg acggcttcag aatggtggca aacgacggct tcatgaaaga cttcgatccg  1200
1201 aaaactcgtt ttgtgagaag cgatcccaca gacaaccagg ttggagaggc ggaaagcgaa  1260
1261 gagaaacgtc tgccgttcga aagtaccata gaagttatta gtttcgagga ggtg  1314
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
6145 7461 -1 Glimmer3 score 13.27 good
Genemark probabilities .94   .98 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu