LOADING...
   TM0009;TM0009
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0009    TM0009            JCSG 281890 Crystal Hit 01-AUG-29

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0009
DESCRIPTIONFerritin/ribonucleotide reductase-like protein
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WXM4_THEMA
DR SPTR; Q9WXM4 (flat text); Q9WXM4 (good view)
DR GenBank; AAD35103
DR Pfam; PF02915; Rubrerythrin;
DR PDB; 1VJX; Highly similar; 13-APR-04; PUTATIVE FERRITIN-LIKE DIIRON-CARBOXYLATE PROTEIN CHAIN: A;
DR FFAS; 281890; Fold and function assignment.
DR TVPC; TM0009; Homologs in PDB, JCSG and SG center.
DR OVP; TM0009; Ortholog view popup.
DR TPM; TM0009; Target PDB monitor.
DR FSS; TM0009; Target function coverage.
PROPERTY Residues: 142 aa
Molecule Weight: 16670.96 Dalton
Isoelectric Point: 4.72
Extinction Coefficient: 10430
Gravy Index: -.65
Number of Met residues: 1
Percentage of Met residues: 0.70 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 142 aa
>TM0009  TM0009 hypothetical protein
MIGPRDLLNIALRIESTGYSYYKNLTEKTEGETKALFERLAEQERDHSRKFKEILEKYEQ
DLNPSDEVLGYLEALAEISIFPKLEETPPDDLREAVRRAIEVEKDSIVFYSEILSYVPEK
EPVQTIIDEEKKHLRDLLRLEV

CDS  cDNA 426 bp
   1 atgataggcc caagggatct tctgaatata gctttgagga tcgaatcaac cggttactct    60
  61 tactacaaga atctcacgga gaaaacggag ggggaaacga aggcactctt tgaacgactg   120
 121 gcggaacaag agagggacca ctccagaaag ttcaaggaga tcctcgaaaa atacgagcag   180
 181 gatcttaacc catccgatga ggtgctcggc tatctcgaag ctctcgcaga gatctctatc   240
 241 tttcccaagc tcgaagaaac tccccctgat gatctgagag aggctgtgag aagggccatc   300
 301 gaagtggaaa aagattccat agtcttttac agcgaaatat tgagctacgt accggagaaa   360
 361 gaacccgttc agacgatcat cgatgaggag aaaaagcatc tgagggacct tctgagactg   420
 421 gaagtg   426
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
8205 8633 -3 Glimmer3 score 14.37 good
Genemark probabilities .91   .79 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu