LOADING...
   TM0010;TM0010
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0010    TM0010            JCSG 281891 Crystal Hit 05-MAY-02

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0010
DESCRIPTIONNADH dehydrogenase I chain F (EC 1.6.5.3)
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WXM5_THEMA
DR SPTR; Q9WXM5 (flat text); Q9WXM5 (good view)
DR GenBank; AAD35104
DR Pfam; PF01512; Complex1_51K;
DR Pfam; PF10589; NADH_4Fe-4S;
DR Pfam; PF10531; SLBB;
DR Pfam; PF00037; Fer4;
DR Interpro; IPR001450; 4Fe4S_ferredoxin;
DR Interpro; IPR001949; Complex1_51K;
DR PDB; 2FUG; Highly similar; 14-FEB-06; NADH-QUINONE OXIDOREDUCTASE CHAIN 1;
DR PDB; 3I9V; Highly similar; 15-SEP-09; NADH-QUINONE OXIDOREDUCTASE SUBUNIT 1;
DR PDB; 3IAM; Highly similar; 15-SEP-09; NADH-QUINONE OXIDOREDUCTASE SUBUNIT 1;
DR PDB; 3IAS; Highly similar; 15-SEP-09; NADH-QUINONE OXIDOREDUCTASE SUBUNIT 1;
DR PDB; 3M9S; Highly similar; 26-MAY-10; NADH-QUINONE OXIDOREDUCTASE SUBUNIT 1;
DR PDB; 2YBB; Highly similar; 19-OCT-11; NADH-QUINONE OXIDOREDUCTASE SUBUNIT 1;
DR PDB; 4HEA; Highly similar; 13-FEB-13; NADH-QUINONE OXIDOREDUCTASE SUBUNIT 1;
DR FFAS; 281891; Fold and function assignment.
DR TVPC; TM0010; Homologs in PDB, JCSG and SG center.
DR OVP; TM0010; Ortholog view popup.
DR TPM; TM0010; Target PDB monitor.
DR FSS; TM0010; Target function coverage.
PROPERTY Residues: 607 aa
Molecule Weight: 66077.85 Dalton
Isoelectric Point: 5.41
Extinction Coefficient: 44810
Gravy Index: -.09
Number of Met residues: 13
Percentage of Met residues: 2.14 %
Number of Cys residues: 23
Percentage of Cys residues: 3.79 %
SEQUENCE  amino acids 607 aa
>TM0010  TM0010 NADP-reducing hydrogenase, subunit C (hndC-1)
MPLTTNTILICAGGACISAGEKSVKDAFEEELRKYGLDEVVRVIETGCMGACTLGPIAVI
YPESVFYQKLTPDAAREIVEEHILKGRIVEKYLYKASEGKPVPRVHEEVPFFKKQVRIVT
RNLGVIDPTKIEEYIARDGYFALAKALQMKPEDVIKEIKDSGLRGRGGAGFPTGLKWELA
ARQKAEKKFVVCNADEGDPGAFMDRSVLEGDPHAVIEGMAIAAYAIGAQKGFVYVRAEYP
LAIERLNIALNQAREYGFLGGNIMGTDFSFDIEIRIGAGAFVCGEETALMASIEGERGQP
KVKPPYPVEKGLWGYPTVINNVETLANVPWIIRNGAKEFRKYGTENSPGTKVFALAGKVK
NTGLVEVPMGITLRELIYEIGGGIAGDKKLKAIQTGGPSGGCIPAEYVDTPVDFESLQKL
GAIMGSGGMIVMDEDDCMVDVARFFLEFTVEESCGKCTPCREGTKKMLEILEKITSGEGT
EEDIEELEKLAHVVKDTSLCGLGQTAPNPVLSTLRYFRDEYLAHVKEKRCPSKKCKALIS
YVIDPEKCVGCTACARVCPVQCISGQVRQPHVIDQAECVRCGSCIEVCRFGAISKVTPAL
PVEEAVE

CDS  cDNA 1821 bp
   1 gtgccgctca caacgaacac gatccttatc tgtgcaggtg gagcgtgtat ttccgccggc    60
  61 gaaaagagtg tcaaagatgc cttcgaagaa gaattgagaa agtacggcct cgatgaagtt   120
 121 gtcagggtga tagagaccgg ttgtatggga gcgtgtacat tgggaccgat tgccgtgatc   180
 181 tacccggaaa gtgtgtttta ccagaaactc acaccagacg cagcaagaga gatcgtcgaa   240
 241 gaacacattt tgaagggaag gatcgtggag aagtaccttt acaaggcttc cgaaggaaaa   300
 301 cctgttccaa gagttcatga ggaagtgcct ttcttcaaga aacaggttag gatcgtcaca   360
 361 aggaatctcg gtgtcataga tcccacgaag atagaggagt acatcgcaag agacggatat   420
 421 tttgcccttg cgaaggctct tcagatgaaa ccggaagacg tgataaagga gataaaggac   480
 481 agcggactca gaggaagagg aggagcgggt tttccaacag ggctcaagtg ggaactcgcg   540
 541 gcaaggcaaa aggccgagaa gaaattcgtt gtctgtaacg cggacgaagg agacccgggt   600
 601 gctttcatgg acagatcggt tcttgaagga gatccacacg ccgtcataga ggggatggca   660
 661 atagccgcct acgcgatagg tgctcagaag gggttcgttt atgtcagggc ggagtatcct   720
 721 ctcgccattg aaaggctcaa catagcgctg aatcaggcaa gagagtacgg tttccttgga   780
 781 ggaaacataa tgggaacgga tttttccttc gatatagaga tcagaatcgg tgcgggtgcg   840
 841 ttcgtttgtg gtgaggaaac cgctttgatg gcctccatag agggtgagag aggccaaccg   900
 901 aaggtgaagc ctccctatcc cgttgagaag ggactctggg gataccccac agtgatcaac   960
 961 aacgttgaaa cacttgcgaa cgtaccctgg atcatcagaa acggtgcgaa agagttcaga  1020
1021 aaatacggga cggagaactc tccgggaacg aaagtattcg ctctcgccgg taaagtgaag  1080
1081 aacacaggtc ttgtggaagt tcccatggga atcacactca gagagctcat atacgagatt  1140
1141 ggaggaggaa tagccggaga caaaaagctg aaagccatcc agactggggg accgagcgga  1200
1201 gggtgtatcc ccgctgagta cgtagacaca cctgttgatt tcgaatccct ccagaaactc  1260
1261 ggtgcaatca tgggttctgg tggaatgata gtgatggacg aagacgactg tatggttgac  1320
1321 gtcgcaaggt tcttcctcga gttcaccgtg gaagaatcct gtggaaaatg tacgccctgt  1380
1381 agagaaggaa cgaagaagat gctcgaaatc ctggagaaga tcacttccgg agagggaaca  1440
1441 gaggaggaca tagaagagct cgaaaagctg gcgcatgtgg taaaggacac ttccctctgt  1500
1501 ggacttggtc aaaccgcacc gaatcctgtt ctttccacac tcagatactt cagagacgag  1560
1561 tatctggcgc atgtcaaaga gaagaggtgt ccatccaaga agtgtaaagc gttgatcagc  1620
1621 tacgtgattg atcctgaaaa atgtgttgga tgtaccgcgt gtgcgagggt ctgtccggtt  1680
1681 cagtgtataa gcggtcaggt gagacagcct cacgtgatag atcaggcgga gtgtgtcagg  1740
1741 tgtggtagct gtatcgaagt ctgtagattt ggagctataa gcaaggttac tccagctctg  1800
1801 ccggtggagg aggcggtaga a  1821
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
8630 10453 -2 Glimmer3 score 11.64 poor
Genemark probabilities .93   .03 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu