LOADING...
   TM0011;TM0011
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0011    TM0011            JCSG 281892 Protein Purification 05-JAN-27

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0011
DESCRIPTIONNADP-reducing hydrogenase, subunit B.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WXM6_THEMA
DR SPTR; Q9WXM6 (flat text); Q9WXM6 (good view)
DR GenBank; AAD35105
DR PDB; 1F37; Highly similar; 26-JUL-00; FERREDOXIN [2FE-2S];
DR PDB; 1M2A; Highly similar; 18-SEP-02; [2FE-2S] FERREDOXIN;
DR PDB; 1M2B; Highly similar; 18-SEP-02; [2FE-2S] FERREDOXIN;
DR PDB; 1M2D; Highly similar; 18-SEP-02; [2FE-2S] FERREDOXIN;
DR FFAS; 281892; Fold and function assignment.
DR TVPC; TM0011; Homologs in PDB, JCSG and SG center.
DR OVP; TM0011; Ortholog view popup.
DR TPM; TM0011; Target PDB monitor.
DR FSS; TM0011; Target function coverage.
PROPERTY Residues: 128 aa
Molecule Weight: 14033.82 Dalton
Isoelectric Point: 7.68
Extinction Coefficient: 2980
Gravy Index: -.13
Number of Met residues: 6
Percentage of Met residues: 4.69 %
Number of Cys residues: 3
Percentage of Cys residues: 2.34 %
SEQUENCE  amino acids 128 aa
>TM0011  TM0011 NADP-reducing hydrogenase, subunit B (hndB)
MRMAKVKSLEELMKIKEQALKDLQLRGETGKRGKITVAMGTCGIAAGAKETLKAIVEALN
EYNINDIAVVQSGCMGLCEVEPTVEVRLEGQEPVIYGRVTPENAKRIVKMHILEGRVVED
LVVKRGEA

CDS  cDNA 384 bp
   1 atgaggatgg ccaaggtgaa gagtctggaa gaactcatga agataaagga acaggctctg    60
  61 aaggatctcc agctgagggg cgaaacaggt aaaaggggga agataactgt tgcgatgggt   120
 121 acgtgtggaa tagcggcggg tgccaaagag actctgaagg cgatcgttga agccctcaat   180
 181 gaatacaaca taaacgatat agcggttgtt cagtcgggtt gtatgggact ctgcgaggtg   240
 241 gaacccaccg ttgaagtgag gctcgaaggt caggagccag tcatatacgg aagggtcact   300
 301 ccggaaaacg caaagagaat cgtgaagatg cacatactcg aaggaagggt cgtcgaagat   360
 361 ctggtggtca aaagaggaga agcc   384
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
10472 10858 -2 Glimmer3 score - -
Genemark probabilities .88   1 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu