LOADING...
   TM0013;TM0013
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0013    TM0013            JCSG 281894 Protein Purification 04-JUL-20

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0013
DESCRIPTIONPutative metallo beta-lactamase
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9S5W7_THEMA
DR SPTR; Q9S5W7 (flat text); Q9S5W7 (good view)
DR GenBank; AAD35107
DR Pfam; PF00753; Lactamase_B;
DR Interpro; IPR001279; Blactmase-like;
DR FFAS; 281894; Fold and function assignment.
DR TVPC; TM0013; Homologs in PDB, JCSG and SG center.
DR OVP; TM0013; Ortholog view popup.
DR TPM; TM0013; Target PDB monitor.
DR FSS; TM0013; Target function coverage.
PROPERTY Residues: 253 aa
Molecule Weight: 29160.21 Dalton
Isoelectric Point: 6.2
Extinction Coefficient: 40910
Gravy Index: -.11
Number of Met residues: 7
Percentage of Met residues: 2.77 %
Number of Cys residues: 3
Percentage of Cys residues: 1.19 %
SEQUENCE  amino acids 253 aa
>TM0013  TM0013 conserved hypothetical protein
MFENEILFDNGQHKFMFLGWEEKEEEIVQTNQYLILDGNEGILLDPGGAHVFPRVMSNVA
EVVDLSSIRHIFYTHQDPDVTSGILLWLSICENAKIYISSLWVRFLPHFGIYDQKRIVPI
SDKGTKIKLLSGNELEILPAHFLHSTGNFVLYDPVAKILFSGDIGAAVFEKGKRYRYVDD
FERHLPLMEAFHKRYMSSNAACKKWVDMVSKKKIDMIAPQHGAVFRGESVKKFLEWFRNL
KCGVDLIDNLYSL

CDS  cDNA 759 bp
   1 atgtttgaaa acgaaatcct cttcgacaac ggtcagcaca aattcatgtt tctgggatgg    60
  61 gaagagaaag aagaagagat cgttcagacg aaccagtatt tgatcctcga tggaaacgaa   120
 121 gggattctcc tggacccggg cggagcacac gtctttccca gggtgatgtc caacgtagcg   180
 181 gaagtggttg atctttccag cataagacat atattctaca cgcatcagga tcccgatgtc   240
 241 acatccggga ttttgctctg gctttcgata tgtgagaacg cgaagatata catatcctct   300
 301 ctctgggtga ggtttctccc acactttgga atctacgatc agaaaaggat cgttccgatc   360
 361 tctgacaaag gaacaaagat aaaactcctg agtggtaacg agctcgagat actcccggcg   420
 421 catttccttc attctactgg gaatttcgtt ctctacgatc cggtggcaaa gatccttttc   480
 481 tcaggagata taggcgccgc ggtgttcgaa aaaggaaaga ggtacaggta cgtcgatgat   540
 541 ttcgaaagac atcttccgct tatggaggcc ttccacaaaa ggtacatgtc ttccaatgcg   600
 601 gcttgcaaga aatgggtgga tatggtttca aagaagaaaa tagatatgat cgcacctcag   660
 661 cacggcgctg tgttcagagg agagtctgtg aagaaattcc tcgagtggtt cagaaatctc   720
 721 aaatgcggtg ttgatctgat agacaatctc tattctttg   759
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
11547 12308 3 Glimmer3 score 13.61 good
Genemark probabilities .9   .93 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu