LOADING...
   TM0014;TM0014
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0014    TM0014            JCSG 281895 Protein Purification 04-JUL-20

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0014
DESCRIPTIONHypothetical protein MPCII.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q7DFA3_THEMA
DR SPTR; Q56315 (flat text); Q56315 (good view)
DR GenBank; CAA59461
DR Interpro; IPR004089; Chmtaxis_transd;
DR PDB; 3G67; Identical; 28-JUL-09; METHYL-ACCEPTING CHEMOTAXIS PROTEIN;
DR PDB; 3G6B; Identical; 28-JUL-09; METHYL-ACCEPTING CHEMOTAXIS PROTEIN;
DR PDB; 4JPB; Identical; 28-AUG-13; CHEMOTAXIS PROTEIN CHEA;
DR PDB; 3UR1; Identical; 07-MAR-12; CHEMOTAXIS PROTEIN CHEA;
DR FFAS; 281895; Fold and function assignment.
DR TVPC; TM0014; Homologs in PDB, JCSG and SG center.
DR OVP; TM0014; Ortholog view popup.
DR TPM; TM0014; Target PDB monitor.
DR FSS; TM0014; Target function coverage.
PROPERTY Residues: 278 aa
Molecule Weight: 31658.48 Dalton
Isoelectric Point: 5.29
Extinction Coefficient: 0
Gravy Index: -.41
Number of Met residues: 9
Percentage of Met residues: 3.24 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 278 aa
>TM0014  TM0014 methyl-accepting chemotaxis protein, putative
MREREIVDKLTSAFFAENTIISFTSQLDEALTRKLRRMQRRIEEVKERFVNLNRLFQELV
GDFQAKSDQLVSVIQDMEKISENIMEELKKSGTNVDQIVERVKEASSQIGETLENIRSIE
KLIQNIMRIARETNILALNATIEAARAGEAGKGFMIVANEVQNLSNETNEVTKQIVEKAR
EILESSQRSLENLEFMANLFETVGKTLQNMVRFMENNVKLLQEVRNSLDTSKESLSEKSA
EIDSATKVLEETAGGFTTINRVINSVITAQRKLKDLKI

CDS  cDNA 834 bp
   1 atgagagaaa gagaaatcgt ggataaactc acttctgcgt tctttgcaga gaacacgatc    60
  61 atatccttca caagccagct ggacgaagca ctgaccagaa agctgagaag aatgcagcgc   120
 121 agaatagagg aagttaaaga aagatttgtg aatctcaaca gactgtttca ggaactggtg   180
 181 ggagattttc aagcgaaaag tgatcagctc gtctctgtca tccaagacat ggaaaagatc   240
 241 agcgaaaaca tcatggagga gttgaaaaaa tccggaacaa atgtagatca gatcgtcgaa   300
 301 agggtgaaag aagcttcatc ccagatagga gagacccttg aaaacataag atcgatcgaa   360
 361 aagttgattc agaacattat gagaatcgcc agggaaacca acatcctcgc cttgaacgcc   420
 421 accatagagg ctgcgagggc cggagaagcg ggaaaaggct tcatgatcgt agcaaacgag   480
 481 gttcagaatc tatcaaacga aacaaatgaa gtgacaaagc agatcgtcga gaaggccaga   540
 541 gaaatcctcg aatcttcaca aagatccctt gaaaacctcg agttcatggc gaatctgttt   600
 601 gaaacagttg gaaaaaccct ccagaatatg gttcgtttca tggaaaacaa cgtaaagctc   660
 661 cttcaggagg tcagaaactc cctcgatacc tcgaaggagt cactctcaga aaagagtgcg   720
 721 gaaatcgaca gtgcaacgaa ggttctggaa gagactgcag gaggattcac gaccataaac   780
 781 agagttatca actcagtgat caccgctcag agaaaactga aggatctaaa gatt   834
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
12318 13154 3 Glimmer3 score 15.08 good
Genemark probabilities .87   .91 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu