LOADING...
   TM0016;TM0016
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0016    TM0016            JCSG 281897 Protein Purification 04-JUL-20

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0016
DESCRIPTIONPyruvate synthase subunit porD (EC 1.2.7.1) (Pyruvate oxidoreductase delta chain) (POR) (Pyruvic-ferredoxin oxidoreductase delta subunit).
ORGANISMThermotoga maritima
COMMENT-!- CATALYTIC ACTIVITY: PYRUVATE + COA + OXIDIZED FERREDOXIN = ACETYL-
COA + CO(2) + REDUCED FERREDOXIN.
-!- COFACTOR: BINDS TWO 4FE-4S CLUSTERS (BY SIMILARITY).
-!- SUBUNIT: HETEROTETRAMER OF ONE ALPHA, ONE BETA, ONE DELTA AND ONE
GAMMA CHAIN.
-!- SIMILARITY: BELONGS TO THE BACTERIAL TYPE FERREDOXIN FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT;
DR SPTR; Q56316 (flat text); Q56316 (good view)
DR GenBank; CAA59456
DR Pfam; PF00037; Fer4;
DR Interpro; IPR001450; 4Fe4S_ferredoxin;
DR KEGG; 1.2.7.1; Enzyme page
DR FFAS; 281897; Fold and function assignment.
DR TVPC; TM0016; Homologs in PDB, JCSG and SG center.
DR OVP; TM0016; Ortholog view popup.
DR TPM; TM0016; Target PDB monitor.
DR FSS; TM0016; Target function coverage.
PROPERTY Residues: 101 aa
Molecule Weight: 11544 Dalton
Isoelectric Point: 7.49
Extinction Coefficient: 22460
Gravy Index: -.31
Number of Met residues: 6
Percentage of Met residues: 5.94 %
Number of Cys residues: 8
Percentage of Cys residues: 7.92 %
SEQUENCE  amino acids 101 aa
>TM0016  TM0016 pyruvate ferredoxin oxidoreductase, delta subunit (porD)
MRMSLKSWKEIPIGGVIDKPGTAREYKTGAWRVMRPILHKEKCIDCMFCWLYCPDQAIIQ
EGGIMKGFNYDYCKGCGLCANVCPKQAIEMRPETEFLSEEG

CDS  cDNA 303 bp
   1 gtgagaatgt ctcttaaaag ctggaaggaa attcccattg gaggagtcat cgacaaaccg    60
  61 ggaacagcaa gagaatacaa aacaggtgcc tggcgtgtga tgagacctat tcttcacaaa   120
 121 gagaaatgta tagactgtat gttctgctgg ctctactgtc cagatcaagc gatcatccaa   180
 181 gaaggcggaa taatgaaagg tttcaactac gactactgta aaggatgcgg actctgtgcg   240
 241 aacgtatgtc caaagcaggc catagagatg agacctgaga ctgagtttct gagcgaggag   300
 301 gga   303
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
13830 14135 3 Glimmer3 score - -
Genemark probabilities .73   .76 poor
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu