LOADING...
   TM0017;TM0017
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0017    TM0017            JCSG 281898 Crystal Fine Screen 03-MAR-05

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0017
DESCRIPTIONPyruvate synthase subunit porA (EC 1.2.7.1) (Pyruvate oxidoreductase alpha chain) (POR) (Pyruvic-ferredoxin oxidoreductase alpha subunit).
ORGANISMThermotoga maritima
COMMENT-!- CATALYTIC ACTIVITY: PYRUVATE + COA + OXIDIZED FERREDOXIN = ACETYL-
COA + CO(2) + REDUCED FERREDOXIN.
-!- SUBUNIT: HETEROTETRAMER OF ONE ALPHA, ONE BETA, ONE DELTA AND
ONE GAMMA CHAIN.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT;
DR SPTR; O05651 (flat text); O05651 (good view)
DR GenBank; CAA59457
DR Pfam; PF01855; POR_N;
DR Interpro; IPR002880; POR_N;
DR PDB; 1B0P; Highly similar; 23-APR-99; PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE);
DR PDB; 2PDA; Highly similar; 23-APR-99; PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE);
DR PDB; 1KEK; Highly similar; 21-DEC-01; PYRUVATE-FERREDOXIN OXIDOREDUCTASE;
DR PDB; 2C3M; Highly similar; 15-FEB-06; PYRUVATE-FERREDOXIN OXIDOREDUCTASE;
DR PDB; 2C3O; Highly similar; 15-FEB-06; PYRUVATE-FERREDOXIN OXIDOREDUCTASE;
DR PDB; 2C3P; Highly similar; 15-FEB-06; PYRUVATE-FERREDOXIN OXIDOREDUCTASE;
DR PDB; 2C3U; Highly similar; 15-FEB-06; PYRUVATE-FERREDOXIN OXIDOREDUCTASE;
DR PDB; 2C3Y; Highly similar; 15-FEB-06; PYRUVATE-FERREDOXIN OXIDOREDUCTASE;
DR KEGG; 1.2.7.1; Enzyme page
DR FFAS; 281898; Fold and function assignment.
DR TVPC; TM0017; Homologs in PDB, JCSG and SG center.
DR OVP; TM0017; Ortholog view popup.
DR TPM; TM0017; Target PDB monitor.
DR FSS; TM0017; Target function coverage.
PROPERTY Residues: 394 aa
Molecule Weight: 44396.6 Dalton
Isoelectric Point: 5.06
Extinction Coefficient: 50310
Gravy Index: -.1
Number of Met residues: 16
Percentage of Met residues: 4.06 %
Number of Cys residues: 1
Percentage of Cys residues: 0.25 %
SEQUENCE  amino acids 394 aa
>TM0017  TM0017 pyruvate ferredoxin oxidoreductase, alpha subunit (porA)
MRMERVVERVAVTGAEAVANAMRQIEPDVVAAYPITPQTPIVEYFARFVADGVVRTEMIP
VESEHSAMSAVVGAAAAGARAMTATSANGLALMHEIVYIAASYRLPIVMPVVNRALSGPI
NIHCDHSDAMAERDSGWIQLFAETNQEAYDFTILAVRLAEHEDVRLPVMVNLDGFILSHG
VEPVEFYPDELVKKFVGELKPMYPLLDTEHPVTWGPLDLYDYYFEHKRQQIEAMENVKKV
FPEIAKEFEETFGRKYWFVEPYRMEDAEHVMVALGSTNSTIKYVVDELREEGYKVGSLKI
WMFRPFPKEQLQELLNGRKSVVVLDRAVSFGAEAPLYEAVKSALYEVAARPMLGSYVYGL
GGRDIKPEHIRKAFEDAINGNLIADEQRYLGLRE

CDS  cDNA 1182 bp
   1 atgaggatgg aaagggtcgt cgagagagtg gccgtcaccg gcgctgaggc cgttgccaat    60
  61 gcgatgagac agatagagcc cgatgtcgtt gcggcgtacc cgatcactcc acagacacct   120
 121 attgtggagt acttcgccag gttcgtcgcg gacggcgttg tcaggacaga aatgattccc   180
 181 gtcgaaagtg aacacagtgc gatgagcgct gtcgttggag ccgctgccgc gggagcaaga   240
 241 gcgatgacag caaccagtgc aaatggactc gcactgatgc acgaaatagt ttacatcgct   300
 301 gcctcctaca gacttcccat tgtgatgccc gttgtgaaca gagcgctcag tggtcctata   360
 361 aacattcact gtgaccacag cgacgcgatg gcagaaaggg attctggatg gattcagctc   420
 421 tttgcggaaa ctaatcagga ggcttacgat ttcaccattc tcgctgtgag actggcagaa   480
 481 cacgaagatg tgagacttcc cgtcatggtg aacctcgatg ggttcatcct ttctcacgga   540
 541 gtggaacccg ttgagttcta tcccgatgaa ctcgtgaaga agttcgttgg agagctcaaa   600
 601 cccatgtatc ctcttctgga tactgaacac cctgtaacct ggggtcctct cgatctttac   660
 661 gattactact tcgaacacaa aagacagcag attgaagcca tggaaaacgt aaagaaggtg   720
 721 ttcccggaaa tcgcaaaaga attcgaagaa acgtttggaa ggaaatactg gtttgtcgaa   780
 781 ccgtacagaa tggaagatgc agagcacgtg atggtagcac tgggctccac aaacagcacg   840
 841 ataaagtacg tggttgatga actgagagaa gaaggctaca aagttggatc tttgaaaatc   900
 901 tggatgttca gaccgttccc gaaggagcag cttcaggaac tcctcaacgg aagaaagagt   960
 961 gtagttgtgc tcgacagagc tgtttccttc ggagcggaag cacctctcta cgaagcagtg  1020
1021 aaatctgcgc tctacgaagt agcagcgagg ccgatgcttg gatcctatgt ctacggtctc  1080
1081 ggtggaaggg acatcaaacc agagcacatc agaaaagcgt tcgaagatgc cataaacgga  1140
1141 aacctcatag cagatgaaca gagatatctt ggtctcagag ag  1182
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
14132 15316 2 Glimmer3 score - -
Genemark probabilities .94   .98 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu