LOADING...
   TM0018;TM0018
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0018    TM0018            JCSG 281899 Protein Purification 04-JUL-20

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0018
DESCRIPTIONPyruvate synthase subunit PORB (EC 1.2.7.1) (Pyruvate oxidoreductase beta chain) (POR) (Pyruvic-ferredoxin oxidoreductase beta subunit).
ORGANISMThermotoga maritima
COMMENT-!- CATALYTIC ACTIVITY: PYRUVATE + COA + OXIDIZED FERREDOXIN = ACETYL-
COA + CO(2) + REDUCED FERREDOXIN.
-!- SUBUNIT: HETEROTETRAMER OF ONE ALPHA, ONE BETA, ONE DELTA AND ONE
GAMMA CHAIN.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; PORB_THEMA
DR SPTR; Q56317 (flat text); Q56317 (good view)
DR GenBank; CAA59458
DR Pfam; PF02775; TPP_enzyme_C;
DR PDB; 1B0P; Highly similar; 23-APR-99; PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE);
DR PDB; 2PDA; Highly similar; 23-APR-99; PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE);
DR PDB; 1KEK; Highly similar; 21-DEC-01; PYRUVATE-FERREDOXIN OXIDOREDUCTASE;
DR PDB; 2C3M; Highly similar; 15-FEB-06; PYRUVATE-FERREDOXIN OXIDOREDUCTASE;
DR PDB; 2C3O; Highly similar; 15-FEB-06; PYRUVATE-FERREDOXIN OXIDOREDUCTASE;
DR PDB; 2C3P; Highly similar; 15-FEB-06; PYRUVATE-FERREDOXIN OXIDOREDUCTASE;
DR PDB; 2C3U; Highly similar; 15-FEB-06; PYRUVATE-FERREDOXIN OXIDOREDUCTASE;
DR PDB; 2C3Y; Highly similar; 15-FEB-06; PYRUVATE-FERREDOXIN OXIDOREDUCTASE;
DR KEGG; 1.2.7.1; Enzyme page
DR FFAS; 281899; Fold and function assignment.
DR TVPC; TM0018; Homologs in PDB, JCSG and SG center.
DR OVP; TM0018; Ortholog view popup.
DR TPM; TM0018; Target PDB monitor.
DR FSS; TM0018; Target function coverage.
PROPERTY Residues: 324 aa
Molecule Weight: 36383.04 Dalton
Isoelectric Point: 8.91
Extinction Coefficient: 44350
Gravy Index: -.34
Number of Met residues: 7
Percentage of Met residues: 2.16 %
Number of Cys residues: 4
Percentage of Cys residues: 1.23 %
SEQUENCE  amino acids 324 aa
>TM0018  TM0018 pyruvate ferredoxin oxidoreductase, beta subunit (porB)
MPVNIKQLAQEFDKKEIGITQGHRLCPGCGAPITVKFVMMIARHLGYEPVVGLATGCLEV
STSIYPYTAWSVPYIHNAFENVAATMSGVETAYKALKNKGKIPEDKKYAFIAFGGDGGTY
DIGLQSLSGMLERGHKVLYVLYDNEGYMNTGNQRSGSTPPGSDTTTAPVGKKLPGKVQLK
KNIVEIVAAHENVYAATASLSEPMDFFAKVEKALNFDGPSFLAVFSPCVRFWRVNDDKTV
EISKLAVETKYWPLYEVERGVYRVTRKPRQFKPVEEFLKAQGRFRKLLSRPDAKEIVDEL
QEYVDRRWERLLTLEEVTKDKPIR

CDS  cDNA 972 bp
   1 atgcccgtta acataaaaca gctggcacag gagttcgata agaaagaaat cggtatcaca    60
  61 cagggtcaca ggctctgtcc aggttgtgga gcacccatca cagtgaagtt cgtgatgatg   120
 121 atcgcaagac acctcggata cgaacccgtt gttggactcg caacaggttg tctggaggtt   180
 181 tctacctcca tctatccgta caccgcttgg agcgtacctt acattcacaa cgcctttgaa   240
 241 aacgtggcag caacgatgag cggtgtggaa acggcttaca aagcactgaa aaacaaagga   300
 301 aagatcccag aagacaaaaa atacgccttc attgcttttg gtggagacgg tggaacgtac   360
 361 gatatcggtc ttcagtcact gtccgggatg ctcgaaagag gtcacaaggt gctctacgtc   420
 421 ctctacgaca acgagggata catgaacaca ggaaaccaga gatccggatc cacacccccg   480
 481 ggttcggata ccacgacagc tccagttgga aagaagctcc ctggaaaggt ccagctgaaa   540
 541 aagaacatcg tcgagatcgt agcggctcac gagaacgtct acgcagctac cgcatcgctc   600
 601 tctgaaccca tggacttctt tgccaaggtg gaaaaggcgc tgaacttcga tggaccttct   660
 661 ttccttgcgg tcttctctcc ttgcgtcagg ttctggagag tgaacgacga taaaacagta   720
 721 gaaatatcaa aactcgccgt agaaacgaag tactggcctt tgtacgaagt ggaaagagga   780
 781 gtttacagag tcaccagaaa accgagacag ttcaaacctg tggaggaatt cctgaaggct   840
 841 cagggaaggt tcagaaaact tctttcaaga ccggatgcaa aagaaatcgt agacgaactc   900
 901 caggaatacg tcgacagaag atgggaaaga ctactcacac tggaagaggt tacaaaggac   960
 961 aaaccgatta ga   972
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
15331 16305 1 Glimmer3 score 14.04 good
Genemark probabilities .92   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu