LOADING...
   TM0019;TM0019
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0019    TM0019            JCSG 281900 Screening 07-APR-20

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0019
DESCRIPTIONPutative oxidoreductase TM0019 (EC 1.-.-.-).
ORGANISMThermotoga maritima
COMMENT-!- SIMILARITY: BELONGS TO THE SHORT-CHAIN DEHYDROGENASES/REDUCTASES
(SDR) FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; Y019_THEMA
DR SPTR; Q56318 (flat text); Q56318 (good view)
DR GenBank; CAA59459
DR Pfam; PF00106; adh_short;
DR Interpro; IPR002198; ADH_short;
DR PDB; 3GED; Highly similar; 17-MAR-09; SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR;
DR PDB; 3GEG; Highly similar; 17-MAR-09; SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR;
DR PDB; 4NI5; Highly similar; 13-NOV-13; OXIDOREDUCTASE, SHORT-CHAIN DEHYDROGENASE/REDUCTA PROTEIN;
DR PDB; 2D1Y; Highly similar; 02-MAR-06; HYPOTHETICAL PROTEIN TT0321;
DR PDB; 4FN4; Highly similar; 15-AUG-12; SHORT CHAIN DEHYDROGENASE;
DR PDB; 4DQX; Highly similar; 29-FEB-12; PROBABLE OXIDOREDUCTASE PROTEIN;
DR PDB; 1ZJY; Highly similar; 21-JUN-05; R-SPECIFIC ALCOHOL DEHYDROGENASE;
DR PDB; 1ZJZ; Highly similar; 21-JUN-05; R-SPECIFIC ALCOHOL DEHYDROGENASE;
DR KEGG; 1.; Enzyme page
DR FFAS; 281900; Fold and function assignment.
DR TVPC; TM0019; Homologs in PDB, JCSG and SG center.
DR OVP; TM0019; Ortholog view popup.
DR TPM; TM0019; Target PDB monitor.
DR FSS; TM0019; Target function coverage.
PROPERTY Residues: 256 aa
Molecule Weight: 28076.73 Dalton
Isoelectric Point: 5.42
Extinction Coefficient: 25440
Gravy Index: -.11
Number of Met residues: 8
Percentage of Met residues: 3.12 %
Number of Cys residues: 3
Percentage of Cys residues: 1.17 %
SEQUENCE  amino acids 256 aa
>TM0019  TM0019 oxidoreductase, short chain dehydrogenase/reductase family
MLEGKVAVVTGGGQGIGAAIAQLFAENGMKVVIAEIDEEAGVEREEMLRERGLDVTFVKT
DVADENSVKNMVRKTVEIYGGVDVLVNNAAVMSVKSIFERPLEEWERVIRVNLTGPYICS
RYCAEEMIKRGGGVIINIASTRAFQSEPDTEPYSASKGGLVALTHSLAVSLSRYHIRVVS
ISPGWIETSEWKKKSLRKKPDLRPIDHEQHPAGRVGNPLDIAHLCVFLADDEKAGFITGT
NFIVDGGMTVKMIYEE

CDS  cDNA 768 bp
   1 atgctcgaag gcaaggtggc agtcgttaca ggtggaggtc agggaatcgg agccgcgatc    60
  61 gctcagcttt ttgcggaaaa cggcatgaag gtagtcatag cagagataga cgaagaagcg   120
 121 ggcgttgaaa gagaagagat gttgagagaa agagggctgg atgtcacatt cgtaaaaacg   180
 181 gacgttgcag atgaaaactc cgtgaagaac atggtgagaa aaaccgtcga aatatacggc   240
 241 ggggtagacg ttctggtgaa caacgcagcc gtcatgtccg tgaagagcat cttcgaaaga   300
 301 cctctcgaag aatgggagag agtgatcagg gtgaacctca cggggcctta catctgttct   360
 361 cgatactgcg cggaagaaat gataaaacgc ggtggcggag tgatcataaa catagcaagc   420
 421 acaagggcat ttcagtcaga accagacacg gaaccctact cagcttcaaa aggaggcctt   480
 481 gtggcactca cgcactcctt ggccgtgagt ctttccagat atcacataag agtggtgagc   540
 541 ataagccccg gctggataga aacatcggaa tggaagaaga agtccctgag aaaaaaaccc   600
 601 gatctgagac ccatcgatca cgaacagcac ccggctggaa gagttggaaa tcccttagat   660
 661 attgcccatc tctgcgtctt tctcgcggac gacgaaaaag caggtttcat aacaggcacg   720
 721 aacttcatcg tcgatggtgg tatgacggtg aagatgatat acgaggag   768
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
16347 17117 3 Glimmer3 score 10.87 poor
Genemark probabilities .93   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu