LOADING...
   TM0020;TM0020
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0020    TM0020            JCSG 281901 Protein Purification 04-JUL-20

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0020
DESCRIPTIONProtein crcB homolog.
ORGANISMThermotoga maritima
COMMENT-!- SUBCELLULAR LOCATION: INTEGRAL MEMBRANE PROTEIN (POTENTIAL).
-!- SIMILARITY: BELONGS TO THE CRCB FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; CRCB_THEMA
DR SPTR; Q9WXM8 (flat text); Q9WXM8 (good view)
DR GenBank; AAD35114
DR Pfam; PF02537; CRCB;
DR Interpro; IPR003691; Camphor_CrcB;
DR FFAS; 281901; Fold and function assignment.
DR TVPC; TM0020; Homologs in PDB, JCSG and SG center.
DR OVP; TM0020; Ortholog view popup.
DR TPM; TM0020; Target PDB monitor.
DR FSS; TM0020; Target function coverage.
PROPERTY Residues: 127 aa
Molecule Weight: 13762.45 Dalton
Isoelectric Point: 6.15
Extinction Coefficient: 8940
Gravy Index: .96
Number of Met residues: 3
Percentage of Met residues: 2.36 %
Number of Cys residues: 1
Percentage of Cys residues: 0.79 %
SEQUENCE  amino acids 127 aa
>TM0020  TM0020 conserved hypothetical protein
MIELDYLTIAFGGAIGAVLRYLVSRTINSLLPFSYIPLGTIIVNSVGSFFLSFLMFAAIE
KVPLSKEAILFFGTGLLGAFTTFSTFTYETLSLIEESPARGVAYALANLLFAFTCAYFGM
ILGRGKV

CDS  cDNA 381 bp
   1 gtgatcgagc tggattacct gacaattgca ttcggaggag cgattggagc cgttctcaga    60
  61 taccttgttt cccgtacgat caattcactc ctgccgttct cttacatacc acttggcacg   120
 121 atcatcgtga actctgtggg ttcttttttt ctttcgtttt tgatgttcgc cgctatcgag   180
 181 aaagttcctc tctctaagga agccatcctt ttcttcggaa cggggcttct gggagccttc   240
 241 accacttttt ccacatttac ttacgaaacg ctctcgctca tcgaagagag tcccgcaagg   300
 301 ggagtcgctt atgctcttgc caatcttctc tttgctttta catgcgccta ctttggaatg   360
 361 attctgggga gggggaaggt a   381
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
17114 17497 2 Glimmer3 score 7.47 poor
Genemark probabilities .72   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu