|
TM0020;TM0020 |
Protein Sequence Comparative Analysis (PSCA) | |
|
TM0020 TM0020 JCSG 281901 Protein Purification 04-JUL-20 Protein Sequence Information
SEQUENCE amino acids 127 aa >TM0020 TM0020 conserved hypothetical protein MIELDYLTIAFGGAIGAVLRYLVSRTINSLLPFSYIPLGTIIVNSVGSFFLSFLMFAAIE KVPLSKEAILFFGTGLLGAFTTFSTFTYETLSLIEESPARGVAYALANLLFAFTCAYFGM ILGRGKV CDS cDNA 381 bp 1 gtgatcgagc tggattacct gacaattgca ttcggaggag cgattggagc cgttctcaga 60 61 taccttgttt cccgtacgat caattcactc ctgccgttct cttacatacc acttggcacg 120 121 atcatcgtga actctgtggg ttcttttttt ctttcgtttt tgatgttcgc cgctatcgag 180 181 aaagttcctc tctctaagga agccatcctt ttcttcggaa cggggcttct gggagccttc 240 241 accacttttt ccacatttac ttacgaaacg ctctcgctca tcgaagagag tcccgcaagg 300 301 ggagtcgctt atgctcttgc caatcttctc tttgctttta catgcgccta ctttggaatg 360 361 attctgggga gggggaaggt a 381Warning: the change of start codon from ATG/M to GTG/V; Target constructs Download sequence in PIR or FASTA format Chemical properties of sequence with tag
Notes The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951). Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function. |