LOADING...
   TM0108;TM0108
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0108    TM0108            JCSG 281989 Protein Purification 04-JUL-19

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0108
DESCRIPTIONUDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC 2.5.1.7) (Enoylpyruvate transferase) (UDP-N-acetylglucosamine enolpyruvyl transferase) (EPT).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: CELL WALL FORMATION. ADDS ENOLPYRUVYL TO UDP-N-
ACETYLGLUCOSAMINE. TARGET FOR THE ANTIBIOTIC PHOSPHOMYCIN.
-!- CATALYTIC ACTIVITY: PHOSPHOENOLPYRUVATE + UDP-N-ACETYL-D-
GLUCOSAMINE = PHOSPHATE + UDP-N-ACETYL-3-(1-CARBOXYVINYL)-D-
GLUCOSAMINE.
-!- PATHWAY: PEPTIDOGLYCAN BIOSYNTHESIS; FIRST STEP.
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (PROBABLE).
-!- SIMILARITY: BELONGS TO THE EPSP SYNTHASE FAMILY. MURA SUBFAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; MURA_THEMA
DR SPTR; Q9WXW3 (flat text); Q9WXW3 (good view)
DR GenBank; AAD35202
DR Pfam; PF00275; EPSP_synthase;
DR Interpro; IPR005750; AcGlu_Tran_MurA;
DR Interpro; IPR001986; EPSP_synth;
DR PDB; 3SG1; Highly similar; 29-JUN-11; UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYLTRANSFERASE CHAIN: A,;
DR PDB; 3ISS; Highly similar; 24-NOV-09; UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYLTRANSFERASE CHAIN: A,;
DR PDB; 3SWD; Highly similar; 14-MAR-12; UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYLTRANSFERASE CHAIN: A,;
DR PDB; 1UAE; Highly similar; 04-SEP-97; UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE;
DR PDB; 2Z2C; Highly similar; 20-MAY-08; UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYLTRANSFERASE CHAIN: A,;
DR PDB; 3KQJ; Highly similar; 28-APR-10; UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYLTRANSFERASE CHAIN: A;
DR PDB; 3KR6; Highly similar; 28-APR-10; UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYLTRANSFERASE CHAIN: A;
DR PDB; 1A2N; Highly similar; 29-APR-98; UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE;
DR KEGG; 2.5.1.7; Enzyme page
DR FFAS; 281989; Fold and function assignment.
DR TVPC; TM0108; Homologs in PDB, JCSG and SG center.
DR OVP; TM0108; Ortholog view popup.
DR TPM; TM0108; Target PDB monitor.
DR FSS; TM0108; Target function coverage.
PROPERTY Residues: 421 aa
Molecule Weight: 45962.69 Dalton
Isoelectric Point: 5.19
Extinction Coefficient: 11920
Gravy Index: .05
Number of Met residues: 13
Percentage of Met residues: 3.09 %
Number of Cys residues: 3
Percentage of Cys residues: 0.71 %
SEQUENCE  amino acids 421 aa
>TM0108  TM0108 UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)
MGKLVVQGGAVLEGEVEISGSKNAALPIMAAAILCDEEVILKNVPRLQDVFVMIDILRSI
GFRVEFEENELKIKRENDISQEVPYELVRKMRASFNVLGPIAVRTGRAKVALPGGCSIGV
RPVDFHLEGLKKMGFSIKVEHGFVEACFERRIDYVTITLPFPSVGATEHLMTTAALLKGA
RVVIENAAMEPEIVDLQNFINRMGGHIEGAGTSRIVIEGVEKMQGVEYSIIPDRIEAGTY
LVAIAASRGKGLVKNVNPDHLTNFFEKLEETGAKLKVLGNEVEIEMRERPKAVDVTTNPY
PGFPTDLQPQMMAYLSTASGVSVITENVFKTRFLHVDELKRMGADIEVSGNVAIVKGVEK
LSGAPVEGTDLRATAALLIAGIIADGVTEISNVEHIFRGYEDVIDKFSELGAKIEYVEKE
N

CDS  cDNA 1263 bp
   1 ttgggtaaac tggtcgttca gggtggcgcc gttctcgaag gagaagtgga gatatcgggt    60
  61 tcaaaaaacg ctgctcttcc aataatggca gcagcgattt tgtgtgatga ggaggtaatt   120
 121 ctcaaaaacg taccgagact ccaagatgtc ttcgtcatga tagacatcct gagatccatt   180
 181 ggattcagag tggaattcga ggagaacgaa ctgaagatca aaagagaaaa cgatatctca   240
 241 caggaagtgc cttacgaact tgtcaggaag atgagggcgt ccttcaacgt gctcggtccg   300
 301 atcgctgtga gaactggaag agcgaaggtt gctcttccag gtgggtgttc cataggagtc   360
 361 agacctgtgg actttcatct tgaaggcctc aaaaaaatgg gattctcgat aaaagtggaa   420
 421 catggctttg ttgaagcctg ctttgaaaga agaatcgatt atgtgacgat tacccttcct   480
 481 tttccaagcg ttggtgccac ggagcacctg atgaccacag cggctctctt aaaaggtgcc   540
 541 cgtgtagtga ttgaaaacgc cgcaatggaa cctgaaatcg tagaccttca aaatttcata   600
 601 aacagaatgg gtggacatat tgaaggagcc ggaaccagcc ggatagtgat tgaaggcgtg   660
 661 gagaaaatgc agggagttga atacagcatc attcccgatc gaatagaagc tggaacgtac   720
 721 ctggtagcca tcgcagcaag tcgtggaaaa ggtctggtga agaatgtaaa cccggatcac   780
 781 ctcacaaact tttttgagaa actggaagaa acaggggcga aacttaaagt tcttggaaac   840
 841 gaagtagaga tcgaaatgag agaaagacca aaagcggtgg atgttacaac gaatccgtac   900
 901 cctggttttc ccacggatct tcagcctcag atgatggcgt atctatcgac agcgtcggga   960
 961 gtctcggtta taaccgaaaa cgtcttcaaa acgaggttct tacacgtgga cgagttgaaa  1020
1021 agaatgggag cggacataga agtttctgga aacgtcgcca tagtgaaagg cgttgaaaaa  1080
1081 ctcagcggtg cccccgttga gggaacggat ctcagggcaa ccgctgccct tctcatagcg  1140
1141 ggaatcatag cagatggagt cactgagata agcaacgtcg aacacatatt cagaggttac  1200
1201 gaagatgtca tagacaaatt cagtgaactg ggagcaaaaa tcgagtatgt tgaaaaagaa  1260
1261 aat  1263
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
113550 114815 3 Glimmer3 score 10.21 poor
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu