LOADING...
   TM0287;TM0287
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0287    TM0287            JCSG 282163 Protein Purification 05-JAN-27

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0287
DESCRIPTIONABC transporter, ATP-binding protein.
ORGANISMThermotoga maritima
COMMENT-!- SIMILARITY: BELONGS TO THE ATP-BINDING TRANSPORT PROTEIN FAMILY
(ABC TRANSPORTERS).
DR UNIPROT; Q9WYC3_THEMA
DR SPTR; Q9WYC3 (flat text); Q9WYC3 (good view)
DR GenBank; AAD35375
DR Pfam; PF00005; ABC_tran;
DR Pfam; PF00664; ABC_membrane;
DR Interpro; IPR003593; AAA_ATPase;
DR Interpro; IPR001140; ABC_TM_transpt;
DR Interpro; IPR003439; ABC_transporter;
DR Interpro; IPR005829; Sug_transporter;
DR PDB; 3QF4; Identical; 28-MAR-12; ABC TRANSPORTER, ATP-BINDING PROTEIN;
DR PDB; 4Q4A; Identical; 16-JUL-14; ABC TRANSPORTER;
DR PDB; 4Q4H; Identical; 16-JUL-14; ABC TRANSPORTER;
DR PDB; 4Q4J; Identical; 16-JUL-14; ABC TRANSPORTER;
DR FFAS; 282163; Fold and function assignment.
DR TVPC; TM0287; Homologs in PDB, JCSG and SG center.
DR OVP; TM0287; Ortholog view popup.
DR TPM; TM0287; Target PDB monitor.
DR FSS; TM0287; Target function coverage.
PROPERTY Residues: 577 aa
Molecule Weight: 64356.96 Dalton
Isoelectric Point: 9.07
Extinction Coefficient: 38390
Gravy Index: .24
Number of Met residues: 16
Percentage of Met residues: 2.77 %
Number of Cys residues: 5
Percentage of Cys residues: 0.87 %
SEQUENCE  amino acids 577 aa
>TM0287  TM0287 ABC transporter, ATP-binding protein
MKTLARYLKPYWIFAVLAPLFMVVEVICDLSQPTLLARIVDEGIARGDFSLVLKTGILML
IVALIGAVGGIGCTVFASYASQNFGADLRRDLFRKVLSFSISNVNRFHTSSLITRLTNDV
TQLQNLVMMLLRIVVRAPLLFVGGIVMAVSINVKLSSVLIFLIPPIVLLFVWLTKKGNPL
FRKIQESTDEVNRVVRENLLGVRVVRAFRREEYENENFRKANESLRRSIISAFSLIVFAL
PLFIFIVNMGMIAVLWFGGVLVRNNQMEIGSIMAYTNYLMQIMFSLMMIGNILNFIVRAS
ASAKRVLEVLNEKPAIEEADNALALPNVEGSVSFENVEFRYFENTDPVLSGVNFSVKPGS
LVAVLGETGSGKSTLMNLIPRLIDPERGRVEVDELDVRTVKLKDLRGHISAVPQETVLFS
GTIKENLKWGREDATDDEIVEAAKIAQIHDFIISLPEGYDSRVERGGRNFSGGQKQRLSI
ARALVKKPKVLILDDCTSSVDPITEKRILDGLKRYTKGCTTFIITQKIPTALLADKILVL
HEGKVAGFGTHKELLEHCKPYREIYESQFGNGVMNDA

CDS  cDNA 1731 bp
   1 atgaaaacac tcgccagata tttaaagccg tactggatat ttgccgttct cgcaccgctt    60
  61 ttcatggttg tagaagtgat atgtgatctt tcacaaccca ctcttttggc acgtattgtc   120
 121 gacgaaggaa tcgcgcgtgg agacttttct ctggttttga aaacagggat cctcatgttg   180
 181 atagtggcac tgataggtgc ggtgggagga ataggctgca cggtcttcgc gagctatgcc   240
 241 agtcagaact ttggagccga cttgaggcga gatctcttca gaaaagttct gagtttttct   300
 301 atttccaatg tgaacagatt ccacacttca tctttgataa cgcgtctcac caacgacgtc   360
 361 acgcagcttc aaaacttggt gatgatgctt ctcaggatcg ttgtcagagc gcctcttctc   420
 421 tttgtgggtg gaatagtcat ggcagtgtct atcaacgtga agctttcttc cgttttgatc   480
 481 tttttgatac ctcccatcgt tctcctcttt gtgtggctca ctaagaaagg gaatcctctt   540
 541 tttcgaaaga ttcaagagag caccgacgag gtcaacagag tcgtgagaga aaatctcctg   600
 601 ggtgtcaggg tagtgagggc ctttcgaaga gaagaatacg agaatgagaa ctttcggaaa   660
 661 gcaaacgagt ctctgagaag atccatcatc agtgcctttt cactcattgt tttcgcactg   720
 721 ccccttttca tattcatcgt gaatatgggg atgatcgccg tcctgtggtt tggaggggtt   780
 781 ctcgttagaa acaaccagat ggagatagga agcatcatgg catacacgaa ttacctcatg   840
 841 cagatcatgt tctctctcat gatgatcgga aacattctca atttcattgt aagagccagt   900
 901 gcttctgcaa agagagttct cgaggtgttg aacgaaaaac ctgcgattga agaagcggac   960
 961 aatgccttag cacttccaaa tgtggagggg agcgtttcct tcgaaaatgt cgaattcaga  1020
1021 tacttcgaaa acaccgatcc tgttctcagt ggagtgaact tctccgttaa accaggatca  1080
1081 ctcgttgccg ttctgggtga aacagggtcc ggaaagagca ccctcatgaa cctcattcca  1140
1141 agactcatcg atccagaacg tggacgtgtg gaagtcgatg aactggatgt tcggacggtg  1200
1201 aagctgaaag atctgagagg tcacatatct gctgttcctc aggaaaccgt gctgttttcg  1260
1261 ggaaccatca aagagaacct gaaatgggga agagaagacg ccacagatga tgaaatcgtg  1320
1321 gaggcggcga agatcgctca gatacacgat ttcataatca gtctgcccga aggatacgat  1380
1381 tctcgcgtcg aaagaggggg gagaaacttc tcgggaggtc agaaacagag actctctata  1440
1441 gcccgtgctc ttgtaaaaaa accaaaggta ctgatactcg acgactgcac gagttcagtg  1500
1501 gatcccataa ctgagaaaag aatactggat gggttgaagc gatacacgaa gggatgtacg  1560
1561 accttcatca tcactcagaa gatcccaacg gctcttctcg ccgataagat cctggtcctt  1620
1621 catgaaggga aagtagcggg atttggcacc cacaaagagt tgctcgaaca ctgcaaaccc  1680
1681 tatcgagaga tatatgaatc ccagtttgga aacggggtga tgaacgatgc c  1731
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
303150 304883 3 Glimmer3 score 10.91 poor
Genemark probabilities .89   .77 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu