LOADING...
   TM0288;TM0288
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0288    TM0288            JCSG 282164 Protein Purification 01-DEC-06

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0288
DESCRIPTIONHypothetical ABC transporter ATP-binding protein TM0288.
ORGANISMThermotoga maritima
COMMENT-!- SUBCELLULAR LOCATION: INTEGRAL MEMBRANE PROTEIN (POTENTIAL).
-!- SIMILARITY: BELONGS TO THE ABC TRANSPORTER FAMILY. MSBA SUBFAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; Y288_THEMA
DR SPTR; Q9WYC4 (flat text); Q9WYC4 (good view)
DR GenBank; AAD35376
DR Pfam; PF00664; ABC_membrane;
DR Pfam; PF00005; ABC_tran;
DR Interpro; IPR003593; AAA_ATPase;
DR Interpro; IPR001140; ABC_TM_transpt;
DR Interpro; IPR003439; ABC_transporter;
DR PDB; 3QF4; Identical; 28-MAR-12; ABC TRANSPORTER, ATP-BINDING PROTEIN;
DR PDB; 4Q4A; Identical; 16-JUL-14; ABC TRANSPORTER;
DR PDB; 4Q4H; Identical; 16-JUL-14; ABC TRANSPORTER;
DR PDB; 4Q4J; Identical; 16-JUL-14; ABC TRANSPORTER;
DR PDB; 2HYD; Highly similar; 05-SEP-06; ABC TRANSPORTER HOMOLOG;
DR PDB; 2ONJ; Highly similar; 13-MAR-07; MULTIDRUG EXPORT ATP-BINDING/PERMEASE PROTEIN SAV1866;
DR PDB; 4A82; Highly similar; 11-JAN-12; CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE REGULAT CHAIN: A,;
DR PDB; 1JSQ; Highly similar; 12-SEP-01; PROBABLE TRANSPORT ATP-BINDING PROTEIN MSBA;
DR FFAS; 282164; Fold and function assignment.
DR TVPC; TM0288; Homologs in PDB, JCSG and SG center.
DR OVP; TM0288; Ortholog view popup.
DR TPM; TM0288; Target PDB monitor.
DR FSS; TM0288; Target function coverage.
PROPERTY Residues: 598 aa
Molecule Weight: 67704.53 Dalton
Isoelectric Point: 8.92
Extinction Coefficient: 42860
Gravy Index: .06
Number of Met residues: 15
Percentage of Met residues: 2.51 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 598 aa
>TM0288  TM0288 ABC transporter, ATP-binding protein
MPEIRRRPHGPILEKPALKNPTATLRRLLGYLRPHTFTLIMVFVFVTVSSILGVLSPYLI
GKTIDVVFVPRRFDLLPRYMLILGTIYALTSLLFWLQGKIMLTLSQDVVFRLRKELFEKL
QRVPVGFFDRTPHGDIISRVINDVDNINNVLGNSIIQFFSGIVTLAGAVIMMFRVNVILS
LVTLSIVPLTVLITQIVSSQTRKYFYENQRVLGQLNGIIEEDISGLTVIKLFTREEKEME
KFDRVNESLRKVGTKAQIFSGVLPPLMNMVNNLGFALISGFGGWLALKDIITVGTIATFI
GYSRQFTRPLNELSNQFNMIQMALASAERIFEILDLEEEKDDPDAVELREVRGEIEFKNV
WFSYDKKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQILVDGIDIR
KIKRSSLRSSIGIVLQDTILFSTTVKENLKYGNPGATDEEIKEAAKLTHSDHFIKHLPEG
YETVLTDNGEDLSQGQRQLLAITRAFLANPKILILDEATSNVDTKTEKSIQAAMWKLMEG
KTSIIIAHRLNTIKNADLIIVLRDGEIVEMGKHDELIQKRGFYYELFTSQYGLVVEKE

CDS  cDNA 1794 bp
   1 atgcctgaga tcagaagaag gccacacgga ccaattttag aaaaacccgc actgaaaaat    60
  61 cccacggcca cgttgagaag actcctcggt tatctgagac ctcacacttt cactttgatc   120
 121 atggtctttg ttttcgtcac cgtttcttcc atacttggtg ttctctcacc gtatctcata   180
 181 ggaaaaacga tcgatgttgt cttcgttccg agaagattcg atcttcttcc cagatacatg   240
 241 ctgattctcg gaacgattta tgcgcttacg tctcttctct tctggcttca gggaaaaatc   300
 301 atgttaacgc tttcccaaga tgttgttttt cgtttgagaa aggagctttt cgagaaactt   360
 361 caaagagttc cggtcggctt cttcgacaga acacctcacg gagacatcat aagcagagtc   420
 421 ataaacgatg tggacaatat aaacaacgtt cttggaaaca gtatcattca gttcttctcg   480
 481 ggaattgtga cactcgcagg tgctgtgatc atgatgttca gagtgaatgt gatcctttca   540
 541 ctcgtcacac tctcaatagt tcccttgacc gttctcatca cgcagatcgt ctccagccaa   600
 601 accagaaaat acttctacga aaatcaaaga gtcctcggcc agctcaatgg gatcatagaa   660
 661 gaagacatct ccggcctcac tgtgataaaa ctcttcaccc gtgaggaaaa agagatggag   720
 721 aagttcgacc gggtgaacga gagtctcaga aaggtgggaa cgaaggctca gatcttttca   780
 781 ggtgttctcc cccctctgat gaacatggtc aacaacctcg gatttgccct gatcagcggt   840
 841 tttggaggat ggctcgcctt gaaagacata atcacggtgg gtaccatagc cactttcata   900
 901 ggttactcaa ggcagttcac aagaccgttg aacgagcttt ctaaccagtt caacatgatc   960
 961 cagatggcgc ttgcgagtgc tgaaagaata tttgagattc tcgatctgga ggaagaaaaa  1020
1021 gacgatcctg atgctgtgga actgagagaa gtcagaggag aaatcgagtt caagaatgtc  1080
1081 tggttctcct acgacaagaa aaagcctgtt cttaaagaca taacctttca cataaaaccg  1140
1141 ggtcagaagg ttgcactggt gggtcccaca gggtccggaa agacgacgat cgtgaatctg  1200
1201 ttgatgagat tctacgacgt ggacagaggg cagatcctcg tggatggtat agatataaga  1260
1261 aaaataaaga ggagttctct gagatccagc ataggcatcg tccttcagga tactattttg  1320
1321 ttttccacca ccgtgaaaga aaacctcaaa tacggaaatc ctggcgctac cgacgaagaa  1380
1381 ataaaagaag cagcgaaact gacacattcc gaccacttca taaagcacct gcctgagggt  1440
1441 tacgaaacgg tcctcaccga caacggtgaa gatctgagtc agggtcaaag acagcttctt  1500
1501 gccataacaa gagctttcct tgcgaatcca aagatcctga tactggacga agccaccagc  1560
1561 aacgttgaca caaagacgga gaaaagcata caggcagcca tgtggaaact catggagggg  1620
1621 aagaccagca tcatcatagc tcacagattg aacacgataa aaaacgcaga tctgatcatc  1680
1681 gttttaagag acggagaaat tgtggagatg ggaaaacacg atgagttgat tcaaaagcga  1740
1741 ggcttttatt acgagctctt cacaagccaa tacggtctcg ttgtagaaaa agaa  1794
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
304876 306672 1 Glimmer3 score 14.14 good
Genemark probabilities .94   .78 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu